Result : Q30PL2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000153.1 |
| Organism | Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) (Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251)) |
| Left | 1877684 |
| Right | 1877929 |
| Strand | - |
| Nucleotide Sequence | ATGGGAATGCCTAGTGGACAAGAGCTCTTAATCATCTTAGCGATAGTTGTTTTATTGTTTGGTGCGAAGAAAATACCTGAATTAGCAAAGGGTATTGGCAAGGGAATTAAAAATTTTAAAGCTGAAATGAAAAATGAAGATGATGATACAGAAGTAAAATCAGCTTCAACAGAAGCTCCTAAAAAAGTAGAATCTGCTGAAGAAGTTGCTTCAAAAGAGAGTTCAAAAACTCCAACACAAGCGTAA |
| Sequence | MGMPSGQELLIILAIVVLLFGAKKIPELAKGIGKGIKNFKAEMKNEDDDTEVKSASTEAPKKVESAEEVASKESSKTPTQA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 18065616 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q30PL2 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1877684 | 1877929 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 2 | 309524 | 309754 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 3 | 385548 | 385778 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 4 | 1665036 | 1665275 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 5 | 230637 | 230873 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 6 | 1579608 | 1579844 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 7 | 1783840 | 1784079 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 8 | 190385 | 190627 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 9 | 237772 | 237990 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 10 | 110729 | 110956 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 11 | 2725970 | 2726200 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 12 | 2551405 | 2551635 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 13 | 1424391 | 1424606 | - | NZ_CP059443.1 | Campylobacter fetus |
| 14 | 1496457 | 1496678 | - | NZ_CP012541.1 | Campylobacter concisus |
| 15 | 236586 | 236798 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 16 | 1851115 | 1851345 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 17 | 2847927 | 2848157 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 18 | 1713974 | 1714204 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 19 | 1043295 | 1043534 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 20 | 1019862 | 1020098 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 21 | 1752913 | 1753149 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 22 | 1086596 | 1086835 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 23 | 1317013 | 1317252 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 24 | 1536746 | 1536979 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 25 | 251553 | 251789 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 26 | 2391435 | 2391662 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 27 | 262802 | 263032 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 28 | 404148 | 404381 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 29 | 393960 | 394187 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 30 | 321647 | 321877 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 31 | 198068 | 198286 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 32 | 2273065 | 2273298 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 33 | 470744 | 470968 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 34 | 730586 | 730795 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022826.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05746.17 | 0.94 | 32 | 10.5 | same-strand | DALR anticodon binding domain |
| 2 | PF00750.21 | 0.94 | 32 | 10.5 | same-strand | tRNA synthetases class I (R) |
| 3 | PF03485.18 | 0.79 | 27 | 11 | same-strand | Arginyl tRNA synthetase N terminal domain |
| 4 | PF01467.28 | 0.62 | 21 | 2069 | opposite-strand | Cytidylyltransferase-like |
| 5 | PF02410.17 | 0.62 | 21 | 1737 | opposite-strand | Ribosomal silencing factor during starvation |
++ More..