Result : Q2YPC3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AM040264.1 |
| Organism | Brucella abortus (strain 2308) |
| Left | 277767 |
| Right | 277940 |
| Strand | - |
| Nucleotide Sequence | GTGGCGCCATTGCGCCCGACGCGGCCCTGCCCTGAATGTGGCAAGCCCTCGACGCGCGAGGCCTACCCGTTCTGCTCACCGCGCTGCAAGAACATCGATCTCAATCGCTGGCTTTCCGGCAGCTACGTCATTGCGGGCAAACCGCTCGGCGAAGAAGACGAGAACGATAGCTAA |
| Sequence | MAPLRPTRPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 16299333 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q2YPC3 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 277767 | 277940 | - | NC_007618.1 | Brucella abortus 2308 |
| 2 | 259163 | 259336 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 3 | 259175 | 259348 | - | NC_004310.3 | Brucella suis 1330 |
| 4 | 280224 | 280397 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 5 | 261029 | 261202 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 6 | 1722849 | 1723022 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 7 | 1724858 | 1725031 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 8 | 301597 | 301770 | + | NZ_LT605585.1 | Brucella inopinata |
| 9 | 297397 | 297570 | - | NZ_CP064063.1 | Brucella anthropi |
| 10 | 271777 | 271941 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 11 | 1891465 | 1891644 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 12 | 4600520 | 4600690 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 13 | 3813263 | 3813442 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 14 | 2942381 | 2942551 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 15 | 196508 | 196684 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 16 | 280729 | 280899 | + | NZ_CP054836.1 | Oricola thermophila |
| 17 | 3015256 | 3015450 | - | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 18 | 872955 | 873122 | + | NZ_CP041690.1 | Youhaiella tibetensis |
| 19 | 213698 | 213880 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 20 | 2352424 | 2352606 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 21 | 466303 | 466479 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 22 | 4409994 | 4410197 | + | NZ_CP010803.1 | Martelella endophytica |
| 23 | 297018 | 297170 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 24 | 1774510 | 1774668 | - | NZ_LR134529.1 | Bartonella vinsonii |
| 25 | 324500 | 324682 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 26 | 1643425 | 1643595 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 27 | 693911 | 694090 | - | NZ_CP058235.1 | Bartonella alsatica |
| 28 | 1304644 | 1304808 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 29 | 2122147 | 2122317 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 30 | 2511446 | 2511628 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 31 | 3403495 | 3403689 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 32 | 1601499 | 1601681 | - | NZ_HG965802.1 | Bartonella henselae |
| 33 | 7684105 | 7684287 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 34 | 1233691 | 1233873 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 35 | 8678958 | 8679140 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 36 | 913983 | 914165 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 37 | 1043808 | 1043990 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 38 | 6780495 | 6780677 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 39 | 3340894 | 3341049 | - | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 40 | 6155296 | 6155478 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 41 | 879105 | 879308 | - | NZ_CP016616.1 | Microvirga ossetica |
| 42 | 2842479 | 2842646 | - | NZ_CP021330.1 | Maritalea myrionectae |
| 43 | 720030 | 720212 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 44 | 951486 | 951653 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 45 | 1404106 | 1404288 | + | NZ_CP034588.1 | Silicimonas algicola |
| 46 | 2254303 | 2254488 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 47 | 1700795 | 1700980 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 48 | 5450794 | 5450964 | - | NZ_CP026100.1 | Caulobacter flavus |
| 49 | 331384 | 331524 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 50 | 2568833 | 2569006 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 51 | 461432 | 461614 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 52 | 2033129 | 2033314 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 53 | 939784 | 939969 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 54 | 634923 | 635108 | - | NZ_CP029550.1 | Methylobacterium durans |
| 55 | 1798435 | 1798596 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 56 | 998982 | 999140 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 57 | 1858391 | 1858561 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 58 | 258618 | 258812 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 59 | 2479875 | 2480045 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 60 | 2857072 | 2857260 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 61 | 1327065 | 1327247 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 62 | 3903743 | 3903889 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 63 | 1690033 | 1690200 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 64 | 2469579 | 2469746 | + | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 65 | 518701 | 518907 | - | NZ_CP022579.1 | Oryzomicrobium terrae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007618.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02545.16 | 0.88 | 57 | 102 | same-strand | Maf-like protein |
| 2 | PF01176.21 | 0.71 | 46 | 883.0 | same-strand | Translation initiation factor 1A / IF-1 |
| 3 | PF00815.22 | 0.6 | 39 | 2009 | same-strand | Histidinol dehydrogenase |
++ More..