Result : Q2YKD6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome bd ubiquinol oxidase subunit X (EC 7.1.1.7) |
| NCBI Accession ID | |
| Organism | Brucella abortus (strain 2308) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH |
| Source of smORF | Swiss-Prot |
| Function | Required for correct functioning of cytochrome bd oxidase. {ECO:0000269|Pubmed:22919638}. |
| Pubmed ID | 16299333 22919638 |
| Domain | CDD:413167 |
| Functional Category | Others |
| Uniprot ID | Q2YKD6 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 550050 | 550205 | - | NZ_LT605586.1 | Brucella inopinata |
| 2 | 494031 | 494186 | + | NC_013118.1 | Brucella microti CCM 4915 |
| 3 | 492628 | 492783 | + | NC_004311.2 | Brucella suis 1330 |
| 4 | 492577 | 492732 | + | NC_010104.1 | Brucella canis ATCC 23365 |
| 5 | 796241 | 796396 | - | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
| 6 | 466139 | 466294 | + | NC_009504.1 | Brucella ovis ATCC 25840 |
| 7 | 779889 | 780044 | - | NC_022906.1 | Brucella ceti TE10759-12 |
| 8 | 722240 | 722395 | - | NC_007624.1 | Brucella abortus 2308 |
| 9 | 622831 | 622986 | + | NZ_CP064062.1 | Brucella anthropi |
| 10 | 419677 | 419832 | + | NZ_CP022603.1 | [Ochrobactrum] quorumnocens |
| 11 | 267249 | 267377 | - | NZ_CP020121.1 | Comamonas kerstersii |
| 12 | 3341245 | 3341379 | + | NZ_CP043575.1 | Comamonas koreensis |
| 13 | 404753 | 404887 | + | NZ_CP012023.1 | Celeribacter marinus |
| 14 | 1089310 | 1089468 | - | NZ_CP072611.1 | Aureimonas populi |
| 15 | 2782414 | 2782539 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 16 | 242645 | 242770 | + | NZ_CP041185.1 | Janthinobacterium tructae |
| 17 | 2168526 | 2168651 | - | NZ_LR134302.1 | Achromobacter spanius |
| 18 | 4638804 | 4638929 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 19 | 2721443 | 2721580 | + | NZ_CP051181.1 | Thalassobius gelatinovorus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT605586.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02322.17 | 1.0 | 19 | 17.0 | same-strand | Cytochrome bd terminal oxidase subunit II |
| 2 | PF01654.19 | 1.0 | 19 | 1184.0 | same-strand | Cytochrome bd terminal oxidase subunit I |
| 3 | PF00005.29 | 0.95 | 18 | 2975.5 | same-strand | ABC transporter |
| 4 | PF00664.25 | 0.74 | 14 | 4577 | same-strand | ABC transporter transmembrane region |
| 5 | PF12802.9 | 0.74 | 14 | 6310.0 | same-strand | MarR family |
++ More..