Protein Information |
Information Type | Description |
---|---|
Protein name | Cytochrome bd ubiquinol oxidase subunit X (EC 7.1.1.7) |
NCBI Accession ID | |
Organism | Brucella abortus (strain 2308) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH |
Source of smORF | Swiss-Prot |
Function | Required for correct functioning of cytochrome bd oxidase. {ECO:0000269|Pubmed:22919638}. |
Pubmed ID | 16299333 22919638 |
Domain | CDD:413167 |
Functional Category | Others |
Uniprot ID | Q2YKD6 |
ORF Length (Amino Acid) | 51 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 550050 | 550205 | - | NZ_LT605586.1 | Brucella inopinata |
2 | 494031 | 494186 | + | NC_013118.1 | Brucella microti CCM 4915 |
3 | 492628 | 492783 | + | NC_004311.2 | Brucella suis 1330 |
4 | 492577 | 492732 | + | NC_010104.1 | Brucella canis ATCC 23365 |
5 | 796241 | 796396 | - | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
6 | 466139 | 466294 | + | NC_009504.1 | Brucella ovis ATCC 25840 |
7 | 779889 | 780044 | - | NC_022906.1 | Brucella ceti TE10759-12 |
8 | 722240 | 722395 | - | NC_007624.1 | Brucella abortus 2308 |
9 | 622831 | 622986 | + | NZ_CP064062.1 | Brucella anthropi |
10 | 419677 | 419832 | + | NZ_CP022603.1 | [Ochrobactrum] quorumnocens |
11 | 267249 | 267377 | - | NZ_CP020121.1 | Comamonas kerstersii |
12 | 3341245 | 3341379 | + | NZ_CP043575.1 | Comamonas koreensis |
13 | 404753 | 404887 | + | NZ_CP012023.1 | Celeribacter marinus |
14 | 1089310 | 1089468 | - | NZ_CP072611.1 | Aureimonas populi |
15 | 2782414 | 2782539 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
16 | 242645 | 242770 | + | NZ_CP041185.1 | Janthinobacterium tructae |
17 | 2168526 | 2168651 | - | NZ_LR134302.1 | Achromobacter spanius |
18 | 4638804 | 4638929 | - | NZ_CP053986.1 | Achromobacter denitrificans |
19 | 2721443 | 2721580 | + | NZ_CP051181.1 | Thalassobius gelatinovorus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02322.17 | 1.0 | 19 | 17.0 | same-strand | Cytochrome bd terminal oxidase subunit II |
2 | PF01654.19 | 1.0 | 19 | 1184.0 | same-strand | Cytochrome bd terminal oxidase subunit I |
3 | PF00005.29 | 0.95 | 18 | 2975.5 | same-strand | ABC transporter |
4 | PF00664.25 | 0.74 | 14 | 4577 | same-strand | ABC transporter transmembrane region |
5 | PF12802.9 | 0.74 | 14 | 6310.0 | same-strand | MarR family |