Result : Q2YJ77
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Type IV secretion system putative lipoprotein virB7 |
| NCBI Accession ID | AF226278.1 |
| Organism | Brucella abortus (strain 2308) |
| Left | 6897 |
| Right | 7070 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCGTGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGCTCAGCCTAACCCCGTTGACACTTACGAGGACTAA |
| Sequence | MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED |
| Source of smORF | Swiss-Prot |
| Function | The virB operon is essential for intracellular survival and is not involved in the invasion process. Constitutes a major determinant of virulence in mice. {ECO:0000269|Pubmed:10940027}. |
| Pubmed ID | 10940027 16299333 |
| Domain | CDD:400449 |
| Functional Category | Others |
| Uniprot ID | Q2YJ77 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 31302 | 31475 | + | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
| 2 | 60340 | 60513 | - | NC_009504.1 | Brucella ovis ATCC 25840 |
| 3 | 60467 | 60640 | - | NC_007624.1 | Brucella abortus 2308 |
| 4 | 31331 | 31504 | + | NC_022906.1 | Brucella ceti TE10759-12 |
| 5 | 60629 | 60802 | - | NC_010104.1 | Brucella canis ATCC 23365 |
| 6 | 60628 | 60801 | - | NC_004311.2 | Brucella suis 1330 |
| 7 | 60666 | 60839 | - | NC_013118.1 | Brucella microti CCM 4915 |
| 8 | 1197082 | 1197255 | - | NZ_LT605586.1 | Brucella inopinata |
| 9 | 27186 | 27356 | + | NC_010509.1 | Methylobacterium radiotolerans JCM 2831 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003318.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04956.15 | 0.89 | 8 | 4971.0 | same-strand | TrbC/VIRB2 pilin |
| 2 | PF05101.15 | 1.0 | 9 | 4607 | same-strand | Type IV secretory pathway, VirB3-like protein |
| 3 | PF03135.16 | 1.0 | 9 | 2112 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
| 4 | PF07996.13 | 1.0 | 9 | 1391 | same-strand | Type IV secretion system proteins |
| 5 | PF04610.16 | 1.0 | 9 | 164 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
| 6 | PF04335.15 | 1.0 | 9 | 3 | same-strand | VirB8 protein |
| 7 | PF03524.17 | 1.0 | 9 | 719 | same-strand | Conjugal transfer protein |
| 8 | PF03743.16 | 1.0 | 9 | 1585 | same-strand | Bacterial conjugation TrbI-like protein |
| 9 | PF00437.22 | 1.0 | 9 | 2735 | same-strand | Type II/IV secretion system protein |
++ More..