Result : Q2W8Q9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Magnetosome protein MamI |
| NCBI Accession ID | AP007255.1 |
| Organism | Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Left | 1022939 |
| Right | 1023148 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAGCGTGATTTTCGGACTGCTGGCGCTTGCCCTCGGATTGCTGGGGGTGACGGCATGGTGGTGGTCGGTGACCGAGTTCCTGCGCGGAGCGGTGCCGGTGGCCCTGCTCATCCTTGGCTTGGTCGCGTTGGCCTCCGGGGTGCAATCCGTGCGGTTGCCTCGTTCCAACAAGGGGACCGCTTCAGACCCTGACATCGATGGTTGA |
| Sequence | MPSVIFGLLALALGLLGVTAWWWSVTEFLRGAVPVALLILGLVALASGVQSVRLPRSNKGTASDPDIDG |
| Source of smORF | Swiss-Prot |
| Function | Essential for magnetosome formation (Pubmed:20212111). May bind magnetite (Probable). May be involved in an early stage of magnetosome nucleation (By similarity). {ECO:0000250|UniProtKB:Q6NE62, ECO:0000269|Pubmed:20212111, ECO:0000305|Pubmed:27528487}. |
| Pubmed ID | 16303747 20212111 21883528 21414040 22716969 27528487 28790202 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | Q2W8Q9 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1022939 | 1023148 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 2 | 2501808 | 2502017 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007626.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04286.14 | 1.0 | 2 | 1537.0 | opposite-strand | Protein of unknown function (DUF445) |
| 2 | PF18509.3 | 1.0 | 2 | 0.0 | same-strand | Magnetochrome domain |
| 3 | PF13365.8 | 1.0 | 2 | 0.0 | same-strand | Trypsin-like peptidase domain |
| 4 | PF13180.8 | 1.0 | 2 | 0.0 | same-strand | PDZ domain |
| 5 | PF17820.3 | 1.0 | 2 | 0.0 | same-strand | PDZ domain |
| 6 | PF00595.26 | 1.0 | 2 | 0.0 | same-strand | PDZ domain |
| 7 | PF00089.28 | 1.0 | 2 | 0.0 | same-strand | Trypsin |
| 8 | PF06723.15 | 1.0 | 2 | 3774.0 | same-strand | MreB/Mbl protein |
| 9 | PF01545.23 | 1.0 | 2 | 5157.5 | same-strand | Cation efflux family |
| 10 | PF16916.7 | 1.0 | 2 | 5157.5 | same-strand | Dimerisation domain of Zinc Transporter |
++ More..