Protein Information |
Information Type | Description |
---|---|
Protein name | N(2)-fixation sustaining protein CowN (CO weal-nitrogenase) |
NCBI Accession ID | AP007255.1 |
Organism | Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
Left | 1717553 |
Right | 1717849 |
Strand | + |
Nucleotide Sequence | ATGACCGCGACCACCCAGGCCGACCGCTATATCAGCTTTTCCGGCATCGACTGCGACGGCAACGCCAAGATCGTCCTCGAACGGGTGGTGGCCCTGGTGGCTTTGCCCGAATACGCCAACTGCTTCTGGGACCGCTTCCTGATCCGGCTGGCCGAGGCCGACAAGGTGGGGGCGCGCAAGGCCGACGAGCTGTGTCTGGCCTGCTCCAACACTTATTACATCGAGGAGCTGTTCGAGGCGGCGGGCGATGAGATGGGGCTGGCGGCGCTGCGGCGGCTGGAAGACGAGTGCTGCTGA |
Sequence | MTATTQADRYISFSGIDCDGNAKIVLERVVALVALPEYANCFWDRFLIRLAEADKVGARKADELCLACSNTYYIEELFEAAGDEMGLAALRRLEDECC |
Source of smORF | Swiss-Prot |
Function | Is required to sustain N(2)-dependent growth in the presence of low levels of carbon monoxide (CO). Probably acts by protecting the N(2) fixation ability of the nitrogenase complex, which is inactivated in the presence of CO. {ECO:0000255|HAMAP-Rule:MF_02117}. |
Pubmed ID | 16303747 |
Domain | CDD:411285 |
Functional Category | Others |
Uniprot ID | Q2W6Y4 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1717553 | 1717849 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
2 | 2624747 | 2625043 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
3 | 1472307 | 1472603 | + | NZ_CP012401.1 | Azospirillum thiophilum |
4 | 2010762 | 2011058 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
5 | 737433 | 737729 | + | NZ_CP054619.1 | Azospirillum oryzae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04397.17 | 1.0 | 5 | 142 | same-strand | LytTr DNA-binding domain |
2 | PF02518.28 | 0.8 | 4 | 1665.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
3 | PF13426.9 | 0.8 | 4 | 1665.5 | same-strand | PAS domain |
4 | PF08448.12 | 0.8 | 4 | 1665.5 | same-strand | PAS fold |
5 | PF00989.27 | 0.8 | 4 | 1665.5 | same-strand | PAS fold |
6 | PF00512.27 | 0.8 | 4 | 1665.5 | same-strand | His Kinase A (phospho-acceptor) domain |
7 | PF00691.22 | 0.6 | 3 | 3690 | same-strand | OmpA family |
8 | PF05899.14 | 0.6 | 3 | 3135 | same-strand | EutQ-like cupin domain |
9 | PF00132.26 | 0.6 | 3 | 1873 | same-strand | Bacterial transferase hexapeptide (six repeats) |
10 | PF00588.21 | 0.6 | 3 | 920 | same-strand | SpoU rRNA Methylase family |
11 | PF00072.26 | 0.6 | 3 | 3646.0 | same-strand | Response regulator receiver domain |
12 | PF02743.20 | 0.6 | 3 | 1688 | same-strand | Cache domain |
13 | PF01627.25 | 0.6 | 3 | 1688 | same-strand | Hpt domain |
14 | PF00990.23 | 0.6 | 3 | 5610 | same-strand | Diguanylate cyclase, GGDEF domain |
15 | PF03453.19 | 0.6 | 3 | 7110.0 | same-strand | MoeA N-terminal region (domain I and II) |
16 | PF00994.26 | 0.6 | 3 | 7110.0 | same-strand | Probable molybdopterin binding domain |
17 | PF03454.17 | 0.6 | 3 | 7680 | same-strand | MoeA C-terminal region (domain IV) |
18 | PF12727.9 | 0.6 | 3 | 7747 | same-strand | PBP superfamily domain |