Result : Q2W402
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein RnfH |
| NCBI Accession ID | AP007255.1 |
| Organism | Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Left | 2806177 |
| Right | 2806470 |
| Strand | + |
| Nucleotide Sequence | ATGAAGATCGGAGTCGTCTACGCCCTCCCCTCCCGCCAGTCGTGGCTGTCCATCGACGTGCCGGAGGGGACCACGGTGAAGGAAGCCATCCAGAAGTCGGGCATCCTCAACCAGTTCCCCGAGATCGATCTGGAGACCCAGAAGGTCGGAATCTTCGGCAAGGCCGCTGCCCTGGACGCGGTGGTCGAGGAAGGGGCGCGCATCGAGATCTATCGCCCCATCACCGTCGACCCCAAGACCGTCAAGCGCCGCGCCGCCCCCGAGGCTCCGGCGGCCGGAGGGACCGAGTCATGA |
| Sequence | MKIGVVYALPSRQSWLSIDVPEGTTVKEAIQKSGILNQFPEIDLETQKVGIFGKAAALDAVVEEGARIEIYRPITVDPKTVKRRAAPEAPAAGGTES |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | 16303747 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q2W402 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2806177 | 2806470 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 2 | 2012115 | 2012405 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 3 | 3807610 | 3807900 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 4 | 3037563 | 3037844 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 5 | 2586866 | 2587117 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 6 | 3584900 | 3585160 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 7 | 1110258 | 1110533 | + | NZ_CP072793.1 | Thiothrix unzii |
| 8 | 1055795 | 1056058 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 9 | 76185 | 76487 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 10 | 3713099 | 3713377 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 11 | 1542684 | 1542983 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 12 | 5831778 | 5832074 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 13 | 1876803 | 1877072 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 14 | 2080519 | 2080794 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 15 | 123464 | 123739 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 16 | 3424660 | 3424935 | + | NZ_CP010803.1 | Martelella endophytica |
| 17 | 1849930 | 1850196 | - | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 18 | 3009943 | 3010230 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 19 | 1581496 | 1581777 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 20 | 1957327 | 1957605 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 21 | 3866165 | 3866425 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 22 | 2271488 | 2271751 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 23 | 1352720 | 1352992 | + | NZ_CP064781.1 | Azospira restricta |
| 24 | 862082 | 862366 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 25 | 850126 | 850407 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 26 | 1647986 | 1648279 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 27 | 319406 | 319654 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 28 | 519711 | 519980 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 29 | 571541 | 571837 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 30 | 4205740 | 4206033 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 31 | 1842160 | 1842441 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 32 | 77645 | 77902 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 33 | 1328844 | 1329146 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 34 | 1284401 | 1284661 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 35 | 1740240 | 1740524 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 36 | 700357 | 700623 | + | NZ_LR699114.1 | Aquicella lusitana |
| 37 | 1013534 | 1013800 | + | NZ_CP009978.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 38 | 942430 | 942699 | + | NZ_CP046268.1 | Vibrio spartinae |
| 39 | 626437 | 626694 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 40 | 1674740 | 1675012 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 41 | 2274003 | 2274299 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 42 | 555100 | 555381 | - | NZ_CP016210.1 | Azoarcus olearius |
| 43 | 2922188 | 2922469 | - | NZ_CP065534.1 | Lonsdalea populi |
| 44 | 3652214 | 3652477 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 45 | 2599106 | 2599366 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 46 | 702295 | 702552 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 47 | 913898 | 914212 | - | NZ_CP035900.1 | Burkholderia glumae |
| 48 | 2482152 | 2482394 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 49 | 1303954 | 1304235 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 50 | 2240932 | 2241183 | + | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 51 | 1204474 | 1204725 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 52 | 1206211 | 1206489 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 53 | 2270358 | 2270627 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 54 | 650188 | 650451 | + | NZ_AP014636.1 | Vibrio tritonius |
| 55 | 2575970 | 2576239 | - | NZ_LS483470.1 | Leminorella richardii |
| 56 | 2283983 | 2284267 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 57 | 2016821 | 2017108 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 58 | 1078139 | 1078417 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 59 | 2021554 | 2021847 | - | NZ_CP025120.1 | Kangiella profundi |
| 60 | 3951672 | 3951917 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 61 | 897578 | 897823 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 62 | 841991 | 842233 | + | NZ_LT615367.1 | Dickeya aquatica |
| 63 | 3076289 | 3076558 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 64 | 6035970 | 6036248 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 65 | 2339548 | 2339790 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 66 | 1098359 | 1098607 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 67 | 1142621 | 1142914 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 68 | 399535 | 399819 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 69 | 834637 | 834918 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 70 | 5267841 | 5268119 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 71 | 4316335 | 4316577 | - | NZ_CP039731.1 | Aquitalea aquatilis |
| 72 | 1678705 | 1678962 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 73 | 1368682 | 1368936 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 74 | 1084817 | 1085098 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 75 | 1154608 | 1154865 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 76 | 175937 | 176239 | - | NC_017856.1 | Methylophaga frappieri |
| 77 | 816924 | 817160 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 78 | 4272742 | 4272990 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 79 | 1388585 | 1388830 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 80 | 584387 | 584668 | + | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 81 | 5335392 | 5335640 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 82 | 801735 | 801971 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 83 | 5771631 | 5771873 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 84 | 918770 | 919012 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 85 | 905920 | 906168 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 86 | 909724 | 909966 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 87 | 942951 | 943208 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 88 | 4259137 | 4259388 | - | NZ_CP014205.2 | Pseudomonas glycinae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035467.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03364.22 | 0.65 | 53 | 50 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 2 | PF10604.11 | 0.64 | 52 | 50.0 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF01668.20 | 0.6 | 49 | 1892 | opposite-strand | SmpB protein |
++ More..