Result : Q2W027
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | AP007255.1 |
| Organism | Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Left | 4404672 |
| Right | 4404896 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGCGAGCGCTGCTAAGTTCATCGGTGCCGGTCTGGCTGCTATCGGCATGATCGGTTCGGGTATCGGCGTGGGCAACATCTGGGCGAACCTGATCGCCACCGTTGGCCGCAACCCCTCCGCCAAGGCCAATGTCGAGCTGTACGGCTGGATCGGCTTCGCGGTGACCGAGGCGATCGCGCTGTTCGCCCTGGTCGTCGCTCTGATGGTCCTCTTCGCCTAA |
| Sequence | MEASAAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAIALFALVVALMVLFA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 16303747 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q2W027 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 139
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4404672 | 4404896 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 2 | 2398484 | 2398708 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 3 | 987334 | 987561 | + | NZ_CP014525.1 | Haematospirillum jordaniae |
| 4 | 258329 | 258556 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 5 | 3740053 | 3740280 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 6 | 538229 | 538453 | + | NZ_CP024199.1 | Thalassospira marina |
| 7 | 440576 | 440800 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 8 | 4161277 | 4161501 | - | NZ_CP031555.1 | Thalassospira indica |
| 9 | 824844 | 825068 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 10 | 710958 | 711182 | - | NZ_CP030265.1 | Skermanella pratensis |
| 11 | 145648 | 145872 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 12 | 865050 | 865274 | + | NZ_CP032485.1 | Neokomagataea tanensis |
| 13 | 1123229 | 1123453 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 14 | 522019 | 522246 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
| 15 | 2319467 | 2319691 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 16 | 2128684 | 2128908 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 17 | 4437455 | 4437679 | - | NZ_CP053708.1 | Lichenicola cladoniae |
| 18 | 2800698 | 2800937 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 19 | 567546 | 567770 | + | NZ_CP060244.1 | Entomobacter blattae |
| 20 | 2392560 | 2392784 | - | NZ_CP014681.1 | Kozakia baliensis |
| 21 | 563826 | 564050 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 22 | 1505786 | 1506010 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 23 | 1273458 | 1273682 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 24 | 1024170 | 1024394 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 25 | 2064149 | 2064373 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 26 | 3080986 | 3081213 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 27 | 3166588 | 3166812 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 28 | 1993077 | 1993301 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 29 | 1877776 | 1878000 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 30 | 259736 | 259960 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 31 | 2559505 | 2559729 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 32 | 1336230 | 1336454 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 33 | 2774580 | 2774804 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 34 | 2856454 | 2856678 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 35 | 1103410 | 1103634 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 36 | 1336229 | 1336486 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 37 | 2930297 | 2930521 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 38 | 1310894 | 1311151 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 39 | 4996652 | 4996879 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 40 | 2916541 | 2916798 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 41 | 323296 | 323520 | - | NZ_CP013002.1 | Caulobacter henricii |
| 42 | 756561 | 756785 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 43 | 1931990 | 1932214 | + | NZ_CP026100.1 | Caulobacter flavus |
| 44 | 433627 | 433854 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
| 45 | 4856544 | 4856771 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 46 | 69517 | 69747 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 47 | 1045190 | 1045417 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 48 | 512913 | 513137 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 49 | 4613610 | 4613837 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 50 | 1167287 | 1167511 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 51 | 934668 | 934895 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 52 | 3036980 | 3037204 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 53 | 1268549 | 1268776 | + | NZ_CP071057.1 | Marinicauda algicola |
| 54 | 2713802 | 2714029 | + | NZ_CP071454.1 | Rhizobium lentis |
| 55 | 895122 | 895349 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 56 | 2679870 | 2680097 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 57 | 502631 | 502858 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 58 | 3435072 | 3435299 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 59 | 539660 | 539887 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 60 | 2451390 | 2451614 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 61 | 2699111 | 2699338 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 62 | 884662 | 884889 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 63 | 153411 | 153638 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 64 | 753126 | 753353 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 65 | 460498 | 460725 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 66 | 901477 | 901704 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 67 | 952069 | 952296 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 68 | 443010 | 443237 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 69 | 571653 | 571880 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 70 | 1214405 | 1214632 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 71 | 2904478 | 2904705 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 72 | 955051 | 955278 | + | NZ_CP071604.1 | Rhizobium binae |
| 73 | 958556 | 958783 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 74 | 881821 | 882048 | + | NZ_CP020906.1 | Rhizobium etli |
| 75 | 450866 | 451093 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 76 | 967721 | 967948 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 77 | 479034 | 479261 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 78 | 3221296 | 3221511 | - | NZ_CP032125.1 | Profundibacter amoris |
| 79 | 1702929 | 1703156 | - | NZ_CP054021.1 | Rhizobium indicum |
| 80 | 1095119 | 1095346 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 81 | 318888 | 319115 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 82 | 856628 | 856855 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 83 | 3970777 | 3971004 | + | NZ_CP046908.1 | Stappia indica |
| 84 | 752120 | 752347 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 85 | 686617 | 686844 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 86 | 882013 | 882240 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 87 | 236239 | 236466 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 88 | 349584 | 349808 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 89 | 393292 | 393519 | + | NC_010103.1 | Brucella canis ATCC 23365 |
| 90 | 393290 | 393517 | + | NC_004310.3 | Brucella suis 1330 |
| 91 | 415393 | 415620 | + | NC_009505.1 | Brucella ovis ATCC 25840 |
| 92 | 395100 | 395327 | + | NC_013119.1 | Brucella microti CCM 4915 |
| 93 | 1588832 | 1589059 | - | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 94 | 1591874 | 1592101 | - | NC_022905.1 | Brucella ceti TE10759-12 |
| 95 | 411515 | 411742 | + | NC_007618.1 | Brucella abortus 2308 |
| 96 | 169681 | 169908 | - | NZ_LT605585.1 | Brucella inopinata |
| 97 | 493763 | 493990 | + | NZ_CP064063.1 | Brucella anthropi |
| 98 | 2818368 | 2818595 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 99 | 431758 | 431985 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 100 | 917777 | 918004 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 101 | 1052218 | 1052445 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 102 | 561287 | 561520 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 103 | 1103639 | 1103866 | - | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 104 | 1767814 | 1768038 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 105 | 5826242 | 5826466 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 106 | 3627039 | 3627263 | - | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 107 | 5803151 | 5803375 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 108 | 5227675 | 5227899 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 109 | 1173556 | 1173780 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 110 | 2537824 | 2538048 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 111 | 1691345 | 1691572 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 112 | 2508200 | 2508424 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 113 | 1766055 | 1766279 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 114 | 771992 | 772219 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 115 | 3362789 | 3363019 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 116 | 1817388 | 1817618 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 117 | 476161 | 476391 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 118 | 278357 | 278584 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 119 | 9427538 | 9427765 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 120 | 842549 | 842779 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 121 | 6780926 | 6781153 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 122 | 2256210 | 2256437 | - | NZ_CP054836.1 | Oricola thermophila |
| 123 | 3981362 | 3981592 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 124 | 9055576 | 9055806 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 125 | 1234678 | 1234908 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 126 | 1123375 | 1123605 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 127 | 3437633 | 3437860 | + | NC_015684.1 | Afipia carboxidovorans OM5 |
| 128 | 7072741 | 7072968 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 129 | 772443 | 772682 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 130 | 610287 | 610517 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 131 | 7642371 | 7642601 | + | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 132 | 1086149 | 1086376 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 133 | 2975012 | 2975239 | + | NZ_CP012946.1 | Blastochloris viridis |
| 134 | 220392 | 220619 | - | NZ_AP018907.1 | Blastochloris tepida |
| 135 | 266826 | 267053 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 136 | 164909 | 165136 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 137 | 297030 | 297257 | - | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 138 | 464497 | 464724 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 139 | 921355 | 921582 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007626.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09527.12 | 0.99 | 137 | 883 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 2 | PF00119.22 | 0.99 | 138 | 67.0 | same-strand | ATP synthase A chain |
| 3 | PF00430.20 | 1.0 | 139 | 279.0 | same-strand | ATP synthase B/B' CF(0) |
| 4 | PF02326.17 | 0.82 | 114 | 79.0 | same-strand | Plant ATP synthase F0 |
++ More..