Result : Q2VZ16
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AP007255.1 |
| Organism | Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Left | 4758054 |
| Right | 4758323 |
| Strand | + |
| Nucleotide Sequence | ATGAACCCCATCGGTCTGGGAATGCGCGGTCTGATCCGCCTGTACCAGCTGCTGCTGAGCCCGGTGCTGCCGGCCAGCTGCCGGTTCACGCCGTCCTGTTCCTCTTATGCCATGCAGGCCATCGAGGCGCACGGACCCGTCGGCGGGACGTGGCTGGGCCTCAAGCGTATCTGCCGCTGCCACCCCTGGAACGACGGTGGCTATGACCCCGTTCCTCCCGCTCATACCGAAAGAGGCGGCACCATGTGCCCGTCGCGACTGCCGGAATAG |
| Sequence | MNPIGLGMRGLIRLYQLLLSPVLPASCRFTPSCSSYAMQAIEAHGPVGGTWLGLKRICRCHPWNDGGYDPVPPAHTERGGTMCPSRLPE |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 16303747 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q2VZ16 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 108
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4758054 | 4758323 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 2 | 3950622 | 3950900 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 3 | 3432655 | 3432915 | - | NZ_CP046904.1 | Massilia flava |
| 4 | 4690706 | 4690942 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 5 | 31338 | 31607 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 6 | 4522631 | 4522858 | - | NZ_CP040017.1 | Massilia umbonata |
| 7 | 2095411 | 2095632 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 8 | 329691 | 329948 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 9 | 3638575 | 3638838 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 10 | 137500 | 137727 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 11 | 272361 | 272600 | + | NZ_CP063145.1 | Cruoricaptor ignavus |
| 12 | 3111391 | 3111642 | - | NZ_CP033932.1 | Chryseobacterium bernardetii |
| 13 | 338191 | 338448 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 14 | 147053 | 147310 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 15 | 6801564 | 6801827 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 16 | 2958651 | 2958884 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 17 | 254888 | 255163 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 18 | 5834394 | 5834666 | - | NZ_CP016172.1 | Bordetella flabilis |
| 19 | 3290840 | 3291097 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 20 | 1809943 | 1810218 | + | NZ_CP051774.1 | Luteolibacter luteus |
| 21 | 2639281 | 2639535 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 22 | 5602841 | 5603077 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 23 | 2320953 | 2321177 | + | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 24 | 3438 | 3695 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 25 | 2327203 | 2327460 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 26 | 3424405 | 3424662 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 27 | 2215922 | 2216140 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 28 | 674828 | 675079 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 29 | 4738883 | 4739140 | - | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 30 | 2727954 | 2728211 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 31 | 2141539 | 2141784 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 32 | 3135098 | 3135355 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 33 | 403553 | 403834 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 34 | 647793 | 648065 | - | NC_018518.1 | Bordetella pertussis 18323 |
| 35 | 4057022 | 4057294 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 36 | 5198486 | 5198758 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 37 | 5729779 | 5729997 | + | NZ_CP055156.1 | Adhaeribacter swui |
| 38 | 3282154 | 3282390 | - | NZ_LR134503.1 | Kaistella jeonii |
| 39 | 4998341 | 4998634 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 40 | 2538664 | 2538939 | - | NZ_LR134302.1 | Achromobacter spanius |
| 41 | 2868240 | 2868476 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 42 | 3813922 | 3814179 | - | NZ_CP046268.1 | Vibrio spartinae |
| 43 | 3813865 | 3814134 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 44 | 3474242 | 3474475 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 45 | 2870430 | 2870690 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 46 | 6427557 | 6427829 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 47 | 3574653 | 3574880 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 48 | 1824043 | 1824270 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 49 | 2870500 | 2870757 | - | NZ_AP019657.1 | Vibrio ponticus |
| 50 | 4300 | 4560 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 51 | 2300860 | 2301111 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 52 | 4762818 | 4763045 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 53 | 3175696 | 3175914 | - | NZ_CP046909.1 | Paraburkholderia acidiphila |
| 54 | 2993585 | 2993842 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 55 | 3213781 | 3214032 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 56 | 4075904 | 4076152 | - | NC_013861.1 | Legionella longbeachae NSW150 |
| 57 | 2172092 | 2172322 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 58 | 1128577 | 1128816 | + | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 59 | 3244795 | 3245052 | - | NZ_CP072793.1 | Thiothrix unzii |
| 60 | 2032661 | 2032897 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 61 | 2130928 | 2131161 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 62 | 721725 | 722015 | + | NZ_CP024199.1 | Thalassospira marina |
| 63 | 4030230 | 4030460 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 64 | 894506 | 894724 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 65 | 3008160 | 3008390 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 66 | 3525115 | 3525411 | - | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 67 | 3852980 | 3853210 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 68 | 1801769 | 1802005 | + | NZ_CP059567.1 | Neisseria shayeganii |
| 69 | 3129070 | 3129300 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 70 | 241524 | 241772 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 71 | 2238541 | 2238801 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 72 | 28744 | 28974 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 73 | 3438903 | 3439157 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 74 | 458634 | 458882 | - | NZ_CP012661.1 | Defluviimonas alba |
| 75 | 3712424 | 3712696 | + | NC_010645.1 | Bordetella avium 197N |
| 76 | 4514261 | 4514497 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 77 | 562104 | 562343 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 78 | 4564821 | 4565078 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 79 | 3844300 | 3844527 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 80 | 1774060 | 1774281 | - | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 81 | 838299 | 838538 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 82 | 1708478 | 1708726 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 83 | 3668722 | 3668997 | + | NZ_CP043146.1 | Bordetella holmesii |
| 84 | 957177 | 957422 | + | NZ_CP045072.1 | Paracoccus kondratievae |
| 85 | 4221000 | 4221242 | - | NZ_CP037951.1 | Parashewanella tropica |
| 86 | 9134046 | 9134264 | - | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 87 | 587000 | 587254 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 88 | 368201 | 368470 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 89 | 8649909 | 8650127 | + | NZ_CP012109.1 | Myxococcus hansupus |
| 90 | 243018 | 243260 | - | NZ_CP068345.1 | Succinivibrio dextrinosolvens |
| 91 | 832779 | 833015 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 92 | 1168030 | 1168257 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 93 | 4278334 | 4278588 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 94 | 410257 | 410484 | - | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 95 | 5467559 | 5467801 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 96 | 8956910 | 8957128 | - | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 97 | 10349469 | 10349687 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 98 | 674172 | 674396 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 99 | 3791021 | 3791269 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 100 | 3465812 | 3466069 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 101 | 10078792 | 10079010 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 102 | 1898100 | 1898354 | - | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 103 | 2821732 | 2821980 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 104 | 2500757 | 2501032 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 105 | 15042 | 15296 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 106 | 2424957 | 2425211 | - | NZ_CP021081.1 | Deinococcus ficus |
| 107 | 2415831 | 2416076 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 108 | 1349931 | 1350158 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007626.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00468.19 | 0.66 | 71 | 431 | same-strand | Ribosomal protein L34 |
| 2 | PF00825.20 | 0.64 | 69 | -3 | same-strand | Ribonuclease P |
| 3 | PF14849.8 | 0.63 | 68 | 19.0 | same-strand | YidC periplasmic domain |
| 4 | PF02096.22 | 0.73 | 79 | 19 | same-strand | 60Kd inner membrane protein |
++ More..