Result : Q2T1N2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein BTH_I0359 |
| NCBI Accession ID | CP000086.1 |
| Organism | Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) |
| Left | 400848 |
| Right | 401105 |
| Strand | - |
| Nucleotide Sequence | ATGCAAATGATCTACAACAGCCCCAACTACTGCGTCGTCGAATTTCCGCCGCAGGACGGCCACCACGCGATGAACTCGGGTGGCTACGAAATCGTCGACAAGAACGCGCAGCGCGAAATCTTCATCGACGGCGAACTCGCCGCGCGCTTTCGCGAGCACGTGAAGCAGTTGATCCAGGCCGAGCCGTCGCTCGACGAGGTCGACGAATTCCTCGGACAGTTCGACAGCCTGATGACGCAACCCGTCGTTCTCCACTGA |
| Sequence | MQMIYNSPNYCVVEFPPQDGHHAMNSGGYEIVDKNAQREIFIDGELAARFREHVKQLIQAEPSLDEVDEFLGQFDSLMTQPVVLH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam12091. Profile Description: Protein of unknown function (DUF3567). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif. |
| Pubmed ID | 16336651 25786241 |
| Domain | CDD:403349 |
| Functional Category | Others |
| Uniprot ID | Q2T1N2 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 740484 | 740741 | - | NZ_CP009727.1 | Burkholderia mallei |
| 2 | 1342021 | 1342278 | + | NZ_CP008781.1 | Burkholderia pseudomallei |
| 3 | 400848 | 401105 | - | NC_007651.1 | Burkholderia thailandensis E264 |
| 4 | 1347327 | 1347584 | + | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 5 | 3401151 | 3401408 | + | NZ_CP020737.1 | Paraburkholderia acidophila |
| 6 | 3436577 | 3436834 | + | NZ_CP013459.1 | Burkholderia stagnalis |
| 7 | 3619757 | 3620014 | + | NZ_CP013414.1 | Burkholderia ubonensis |
| 8 | 3910802 | 3911059 | + | NZ_CP002580.1 | Burkholderia plantarii |
| 9 | 210818 | 211075 | - | NZ_CP009795.1 | Burkholderia dolosa AU0158 |
| 10 | 2009170 | 2009427 | + | NZ_CP035900.1 | Burkholderia glumae |
| 11 | 3235911 | 3236168 | + | NZ_CP009832.1 | Burkholderia multivorans ATCC BAA-247 |
| 12 | 3238959 | 3239216 | + | NZ_CP013398.1 | Burkholderia seminalis |
| 13 | 994351 | 994608 | + | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 14 | 3305346 | 3305603 | + | NZ_CP013450.1 | Burkholderia cenocepacia |
| 15 | 3416176 | 3416433 | + | NC_007510.1 | Burkholderia lata |
| 16 | 216124 | 216381 | - | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 17 | 3283160 | 3283417 | + | NZ_CP013401.1 | Burkholderia metallica |
| 18 | 3383226 | 3383483 | + | NZ_CP045235.1 | Burkholderia cepacia |
| 19 | 241379 | 241636 | - | NZ_CP026111.1 | Paraburkholderia terrae |
| 20 | 1821296 | 1821553 | + | NZ_CP015958.1 | Paraburkholderia caribensis |
| 21 | 2342750 | 2343007 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 22 | 278591 | 278848 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 23 | 929167 | 929424 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 24 | 531303 | 531560 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 25 | 2440744 | 2441001 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 26 | 260087 | 260344 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 27 | 2593944 | 2594201 | + | NZ_CP017561.1 | Paraburkholderia sprentiae WSM5005 |
| 28 | 222992 | 223249 | - | NZ_CP046909.1 | Paraburkholderia acidiphila |
| 29 | 218257 | 218514 | - | NZ_CP029640.1 | Paraburkholderia dokdonella |
| 30 | 191016 | 191273 | - | NZ_CP049134.1 | Paraburkholderia tropica |
| 31 | 319560 | 319817 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 32 | 227441 | 227698 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 33 | 2585889 | 2586146 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 34 | 153363 | 153620 | - | NC_021287.1 | Caballeronia insecticola |
| 35 | 2644038 | 2644295 | + | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 36 | 455005 | 455262 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 37 | 495441 | 495698 | - | NZ_CP010310.2 | Pandoraea pulmonicola |
| 38 | 5047709 | 5047966 | + | NZ_CP013481.2 | Pandoraea apista |
| 39 | 480442 | 480699 | - | NZ_CP047385.1 | Pandoraea fibrosis |
| 40 | 468101 | 468358 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 41 | 477328 | 477585 | - | NZ_LT906435.1 | Pandoraea sputorum |
| 42 | 444480 | 444737 | - | NC_023018.2 | Pandoraea pnomenusa |
| 43 | 505064 | 505321 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 44 | 4024322 | 4024579 | + | NZ_CP011568.3 | Pandoraea thiooxydans |
| 45 | 2170603 | 2170860 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 46 | 511529 | 511786 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 47 | 819338 | 819595 | + | NZ_CP068285.1 | Ralstonia syzygii subsp. celebesensis |
| 48 | 215233 | 215490 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 49 | 2359286 | 2359543 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 50 | 592368 | 592625 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 51 | 70763 | 71020 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 52 | 233432 | 233689 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 53 | 108461 | 108718 | + | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 54 | 161794 | 162051 | + | NZ_CP039287.1 | Cupriavidus necator H16 |
| 55 | 1448558 | 1448815 | + | NZ_CP028324.1 | Massilia armeniaca |
| 56 | 5911172 | 5911429 | + | NZ_CP040017.1 | Massilia umbonata |
| 57 | 5003686 | 5003943 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 58 | 1115755 | 1116012 | + | NZ_CP048832.1 | Janthinobacterium lividum |
| 59 | 1101999 | 1102256 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 60 | 4974881 | 4975138 | + | NZ_CP041185.1 | Janthinobacterium tructae |
| 61 | 1537280 | 1537537 | + | NZ_CP024608.1 | Massilia violaceinigra |
| 62 | 4879156 | 4879413 | + | NZ_CP019038.1 | Massilia putida |
| 63 | 4706365 | 4706622 | + | NZ_CP046904.1 | Massilia flava |
| 64 | 2259701 | 2259958 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 65 | 5920319 | 5920576 | - | NZ_CP036401.1 | Massilia albidiflava |
| 66 | 2307825 | 2308082 | + | NZ_CP034464.1 | Undibacterium parvum |
| 67 | 4457869 | 4458126 | + | NZ_CP013235.1 | Collimonas arenae |
| 68 | 5296454 | 5296711 | + | NZ_CP013236.1 | Collimonas pratensis |
| 69 | 5292174 | 5292431 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 70 | 76537 | 76794 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 71 | 3465318 | 3465575 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 72 | 203702 | 203953 | + | NZ_CP043046.1 | Pigmentiphaga aceris |
| 73 | 617676 | 617927 | - | NZ_LR134378.1 | Lautropia mirabilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009727.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02965.19 | 0.9 | 66 | 1510.0 | same-strand | Vitamin B12 dependent methionine synthase, activation domain |
| 2 | PF00809.24 | 0.9 | 66 | 1510.0 | same-strand | Pterin binding enzyme |
| 3 | PF02607.19 | 0.9 | 66 | 1510.0 | same-strand | B12 binding domain |
| 4 | PF02574.18 | 0.9 | 66 | 317.0 | same-strand | Homocysteine S-methyltransferase |
| 5 | PF11306.10 | 0.73 | 53 | 1093 | same-strand | Protein of unknown function (DUF3108) |
| 6 | PF09339.12 | 0.71 | 52 | 2374.5 | same-strand | IclR helix-turn-helix domain |
| 7 | PF01614.20 | 0.71 | 52 | 2374.5 | same-strand | Bacterial transcriptional regulator |
| 8 | PF01557.20 | 0.73 | 53 | 3449 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 9 | PF18288.3 | 0.73 | 53 | 3449 | opposite-strand | Fumarylacetoacetase N-terminal domain 2 |
++ More..