Result : Q2SMN3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein RnfH |
| NCBI Accession ID | CP000155.1 |
| Organism | Hahella chejuensis (strain KCTC 2396) |
| Left | 1229266 |
| Right | 1229556 |
| Strand | + |
| Nucleotide Sequence | ATGGATAAATTAAAAATTCAGGTGGAAGTGGCTTATGCTTTGCCTGAGCAGCAAAAGATCATTCCTCTGGCCGTGGTGGAGGGCACAACCGCCTACGAAGCCGTCCAGATGTCCGGCATTACTCATTTCTTTCCACAGATCGAGCTGGACTCAGCAAAAATGGGGATATTCGGTAAGTCCATCCCGGAGCCTAAATCCCATGCTTTGAGAGAGGGCGACCGAGTGGAGATATACCGGCCGCTCAAAATTGACCCGAAACAGGCCCGACTGAATCGGGCCAAAAAGGGTTAG |
| Sequence | MDKLKIQVEVAYALPEQQKIIPLAVVEGTTAYEAVQMSGITHFFPQIELDSAKMGIFGKSIPEPKSHALREGDRVEIYRPLKIDPKQARLNRAKKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | 16352867 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q2SMN3 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 89
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1229266 | 1229556 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 2 | 3242456 | 3242743 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 3 | 1671738 | 1672031 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 4 | 919222 | 919488 | + | NZ_CP020931.1 | Marinobacter salarius |
| 5 | 3884626 | 3884919 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 6 | 3968190 | 3968465 | - | NZ_CP061941.1 | Marinomonas algicola |
| 7 | 3950399 | 3950671 | + | NZ_CP017715.1 | Marinobacter salinus |
| 8 | 3503580 | 3503861 | - | NZ_CP011494.1 | Marinobacter psychrophilus |
| 9 | 472802 | 473047 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 10 | 609090 | 609362 | + | NZ_CP061081.1 | Marinomonas arctica |
| 11 | 584399 | 584668 | + | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 12 | 2606996 | 2607274 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 13 | 3076289 | 3076558 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 14 | 451789 | 452073 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 15 | 399535 | 399819 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 16 | 3070394 | 3070636 | - | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 17 | 550025 | 550270 | + | NZ_CP015839.1 | Marinobacterium aestuarii |
| 18 | 834637 | 834957 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 19 | 2887221 | 2887517 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 20 | 3774376 | 3774630 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 21 | 343997 | 344269 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 22 | 2901565 | 2901807 | - | NZ_CP060084.1 | Teredinibacter haidensis |
| 23 | 558168 | 558413 | - | NZ_CP059082.1 | Halomonas titanicae |
| 24 | 338991 | 339230 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 25 | 346862 | 347101 | + | NZ_CP065135.1 | Halomonas venusta |
| 26 | 1142621 | 1142941 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 27 | 1409946 | 1410197 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 28 | 3467946 | 3468197 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 29 | 235159 | 235392 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 30 | 3063714 | 3063980 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 31 | 1965544 | 1965792 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 32 | 1098287 | 1098607 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 33 | 1368616 | 1368936 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 34 | 3168192 | 3168440 | - | NZ_CP011797.1 | Reinekea forsetii |
| 35 | 489127 | 489399 | - | NZ_CP045871.1 | Litoricola lipolytica |
| 36 | 4272742 | 4273062 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 37 | 2005257 | 2005523 | + | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 38 | 700333 | 700623 | + | NZ_LR699114.1 | Aquicella lusitana |
| 39 | 3730444 | 3730758 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 40 | 4029154 | 4029402 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 41 | 335809 | 336051 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 42 | 394295 | 394603 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 43 | 513510 | 513761 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 44 | 923588 | 923860 | + | NZ_CP047241.1 | Aquitalea denitrificans |
| 45 | 1192288 | 1192620 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 46 | 1284395 | 1284661 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 47 | 772494 | 772736 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 48 | 3666964 | 3667248 | - | NZ_CP014226.1 | Halomonas chromatireducens |
| 49 | 4316335 | 4316577 | - | NZ_CP039731.1 | Aquitalea aquatilis |
| 50 | 1468652 | 1468954 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 51 | 3197425 | 3197658 | - | NZ_CP036422.1 | Halioglobus maricola |
| 52 | 891607 | 891885 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 53 | 3037457 | 3037690 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 54 | 1045222 | 1045488 | - | NC_012968.1 | Methylotenera mobilis JLW8 |
| 55 | 2847341 | 2847604 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 56 | 1095069 | 1095326 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 57 | 4409890 | 4410144 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 58 | 2866727 | 2866990 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 59 | 3268142 | 3268399 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 60 | 940876 | 941142 | - | NZ_CP036200.1 | Shewanella maritima |
| 61 | 5335392 | 5335712 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 62 | 2797321 | 2797584 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 63 | 161646 | 161933 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 64 | 1255742 | 1256047 | - | NC_002971.4 | Coxiella burnetii RSA 493 |
| 65 | 1117130 | 1117426 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 66 | 1310625 | 1310930 | - | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 67 | 838793 | 839047 | + | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 68 | 1671025 | 1671312 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 69 | 1897631 | 1897885 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 70 | 4304395 | 4304628 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 71 | 3951627 | 3951917 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 72 | 897578 | 897823 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 73 | 1892713 | 1892991 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 74 | 1107320 | 1107574 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 75 | 1221454 | 1221771 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 76 | 2283983 | 2284267 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 77 | 2816168 | 2816488 | - | NZ_CP002580.1 | Burkholderia plantarii |
| 78 | 1303954 | 1304235 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 79 | 1139537 | 1139794 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 80 | 1294747 | 1295007 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 81 | 1659370 | 1659630 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 82 | 2264417 | 2264659 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 83 | 686991 | 687236 | - | NZ_CP031252.1 | Neisseria elongata |
| 84 | 2808852 | 2809124 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 85 | 1042718 | 1043038 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 86 | 913898 | 914212 | - | NZ_CP035900.1 | Burkholderia glumae |
| 87 | 1114862 | 1115173 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 88 | 758458 | 758700 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 89 | 1876803 | 1877072 | + | NZ_AP017928.1 | Methylocaldum marinum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007645.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 0.94 | 84 | 1701.0 | opposite-strand | SmpB protein |
| 2 | PF03364.22 | 0.94 | 84 | 51.5 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 3 | PF10604.11 | 0.91 | 81 | 50 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 4 | PF04355.15 | 0.81 | 72 | 29.5 | opposite-strand | SmpA / OmlA family |
| 5 | PF01475.21 | 0.7 | 62 | 532.0 | same-strand | Ferric uptake regulator family |
| 6 | PF02463.21 | 0.66 | 59 | 1106.0 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 7 | PF13476.8 | 0.62 | 55 | 1106 | opposite-strand | AAA domain |
++ More..