Result : Q2SA36
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0250 protein HCH_05838 |
| NCBI Accession ID | CP000155.1 |
| Organism | Hahella chejuensis (strain KCTC 2396) |
| Left | 5956601 |
| Right | 5956876 |
| Strand | - |
| Nucleotide Sequence | ATGACCGATAGCCAAAAAGAGGCTCCCAAAATTGAATTTCCCTGCGACTATCCGTTGAAAGTCATCGGTGTGGCGGGGCCTGATTTTCAGGAAGTCGTGGCGACAATTGTGCGCGCCCATGCGCCTGAGTTCGATGCGTCTTCGATTGACGCGCTCGACAGCCGCAACGGTAAATATCTTTCATTGCGTTTTAGCATTCAGGCACAGAGCGAGGAGCATATTCGTCGCCTGTTTCTGGATCTGAAAGCGCACAGCGCCGTGCAAATGGTGTTGTAA |
| Sequence | MTDSQKEAPKIEFPCDYPLKVIGVAGPDFQEVVATIVRAHAPEFDASSIDALDSRNGKYLSLRFSIQAQSEEHIRRLFLDLKAHSAVQMVL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01102. Profile Description: Protein of unknown function (DUF493). hypothetical protein; Provisional |
| Pubmed ID | 16352867 |
| Domain | CDD:412741 |
| Functional Category | Others |
| Uniprot ID | Q2SA36 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5956601 | 5956876 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 2 | 4722405 | 4722674 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 3 | 4021228 | 4021494 | - | NZ_CP048812.1 | Halomonas socia |
| 4 | 1763097 | 1763393 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 5 | 3326416 | 3326694 | + | NZ_CP059082.1 | Halomonas titanicae |
| 6 | 1623058 | 1623279 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048812.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 6 | 726.0 | opposite-strand | Radical SAM superfamily |
| 2 | PF00768.22 | 1.0 | 6 | 133.0 | same-strand | D-alanyl-D-alanine carboxypeptidase |
| 3 | PF07943.15 | 1.0 | 6 | 133.0 | same-strand | Penicillin-binding protein 5, C-terminal domain |
| 4 | PF03330.20 | 1.0 | 6 | 1435.0 | same-strand | Lytic transglycolase |
| 5 | PF05036.15 | 1.0 | 6 | 1435.0 | same-strand | SPOR domain |
| 6 | PF13406.8 | 1.0 | 6 | 2346.0 | same-strand | Transglycosylase SLT domain |
| 7 | PF01098.21 | 1.0 | 6 | 3444.0 | same-strand | Cell cycle protein |
| 8 | PF00905.24 | 1.0 | 6 | 4659.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 9 | PF03717.17 | 1.0 | 6 | 4659.0 | same-strand | Penicillin-binding Protein dimerisation domain |
| 10 | PF03466.22 | 0.67 | 4 | 2052.0 | opposite-strand | LysR substrate binding domain |
| 11 | PF00126.29 | 0.67 | 4 | 2052.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..