Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0250 protein HCH_05838 |
NCBI Accession ID | CP000155.1 |
Organism | Hahella chejuensis (strain KCTC 2396) |
Left | 5956601 |
Right | 5956876 |
Strand | - |
Nucleotide Sequence | ATGACCGATAGCCAAAAAGAGGCTCCCAAAATTGAATTTCCCTGCGACTATCCGTTGAAAGTCATCGGTGTGGCGGGGCCTGATTTTCAGGAAGTCGTGGCGACAATTGTGCGCGCCCATGCGCCTGAGTTCGATGCGTCTTCGATTGACGCGCTCGACAGCCGCAACGGTAAATATCTTTCATTGCGTTTTAGCATTCAGGCACAGAGCGAGGAGCATATTCGTCGCCTGTTTCTGGATCTGAAAGCGCACAGCGCCGTGCAAATGGTGTTGTAA |
Sequence | MTDSQKEAPKIEFPCDYPLKVIGVAGPDFQEVVATIVRAHAPEFDASSIDALDSRNGKYLSLRFSIQAQSEEHIRRLFLDLKAHSAVQMVL |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01102. Profile Description: Protein of unknown function (DUF493). hypothetical protein; Provisional |
Pubmed ID | 16352867 |
Domain | CDD:412741 |
Functional Category | Others |
Uniprot ID | Q2SA36 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5956601 | 5956876 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
2 | 4722405 | 4722674 | - | NZ_CP021425.1 | Oleiphilus messinensis |
3 | 4021228 | 4021494 | - | NZ_CP048812.1 | Halomonas socia |
4 | 1763097 | 1763393 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
5 | 3326416 | 3326694 | + | NZ_CP059082.1 | Halomonas titanicae |
6 | 1623058 | 1623279 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04055.23 | 1.0 | 6 | 726.0 | opposite-strand | Radical SAM superfamily |
2 | PF00768.22 | 1.0 | 6 | 133.0 | same-strand | D-alanyl-D-alanine carboxypeptidase |
3 | PF07943.15 | 1.0 | 6 | 133.0 | same-strand | Penicillin-binding protein 5, C-terminal domain |
4 | PF03330.20 | 1.0 | 6 | 1435.0 | same-strand | Lytic transglycolase |
5 | PF05036.15 | 1.0 | 6 | 1435.0 | same-strand | SPOR domain |
6 | PF13406.8 | 1.0 | 6 | 2346.0 | same-strand | Transglycosylase SLT domain |
7 | PF01098.21 | 1.0 | 6 | 3444.0 | same-strand | Cell cycle protein |
8 | PF00905.24 | 1.0 | 6 | 4659.0 | same-strand | Penicillin binding protein transpeptidase domain |
9 | PF03717.17 | 1.0 | 6 | 4659.0 | same-strand | Penicillin-binding Protein dimerisation domain |
10 | PF03466.22 | 0.67 | 4 | 2052.0 | opposite-strand | LysR substrate binding domain |
11 | PF00126.29 | 0.67 | 4 | 2052.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |