Result : Q2S6I6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000159.1 |
| Organism | Salinibacter ruber (strain DSM 13855 / M31) |
| Left | 36363 |
| Right | 36560 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGTCCCGAAACGACGACATTCGAAGTCGCGCACCCGAAAGCGCCGCTCGACCTATTACAATGAGCTGGAGCCCCCCCAGCTCATGGAGTGCAATAACTGTGGCAACCCGAAGGTGATGCACCGGGCGTGCAAGCACTGCGGGCACTACCGCGGCCGTCAGGTTATCGAGCCGTCCGACGAGCTGATCGCGTAG |
| Sequence | MAVPKRRHSKSRTRKRRSTYYNELEPPQLMECNNCGNPKVMHRACKHCGHYRGRQVIEPSDELIA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16330755 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2S6I6 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 161
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 35570 | 35767 | + | NZ_CP030356.1 | Salinibacter ruber |
| 2 | 3260292 | 3260489 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 3 | 872238 | 872426 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 4 | 1672606 | 1672791 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 5 | 2856520 | 2856708 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 6 | 1200984 | 1201172 | + | NZ_CP031518.1 | Treponema ruminis |
| 7 | 1159264 | 1159455 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 8 | 896379 | 896558 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 9 | 1039243 | 1039416 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 10 | 6400738 | 6400911 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 11 | 1594787 | 1594975 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 12 | 1264498 | 1264686 | + | NZ_CP054142.1 | Treponema parvum |
| 13 | 1858766 | 1858954 | + | NC_023035.1 | Salinispira pacifica |
| 14 | 1869348 | 1869521 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 15 | 2620886 | 2621059 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 16 | 4998737 | 4998922 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 17 | 1785592 | 1785777 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 18 | 3370820 | 3370993 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 19 | 197494 | 197685 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 20 | 1226710 | 1226883 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 21 | 1362718 | 1362906 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 22 | 587760 | 587933 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 23 | 2856026 | 2856217 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 24 | 1466409 | 1466582 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 25 | 1658346 | 1658519 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 26 | 189735 | 189926 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 27 | 5652736 | 5652915 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 28 | 1052967 | 1053140 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 29 | 1661277 | 1661450 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 30 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 31 | 1591605 | 1591787 | - | NZ_CP034118.1 | Staphylospora marina |
| 32 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 33 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 34 | 2393360 | 2393542 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 35 | 822488 | 822661 | + | NZ_LR134483.1 | Listeria grayi |
| 36 | 32541 | 32723 | + | NZ_HF545617.1 | Ruminococcus bicirculans |
| 37 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 38 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 39 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 40 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 41 | 1999192 | 1999383 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 42 | 2669166 | 2669339 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 43 | 1202959 | 1203141 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 44 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 45 | 3814293 | 3814466 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 46 | 3955403 | 3955576 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 47 | 3948807 | 3948980 | - | NC_011725.1 | Bacillus cereus B4264 |
| 48 | 1462250 | 1462426 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 49 | 1414933 | 1415106 | + | NZ_CP040336.1 | Bacillus luti |
| 50 | 3744933 | 3745106 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 51 | 151834 | 152025 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 52 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 53 | 2605547 | 2605738 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 54 | 2269010 | 2269198 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 55 | 2285039 | 2285215 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 56 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 57 | 1678088 | 1678261 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 58 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 59 | 190854 | 191027 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 60 | 1618210 | 1618383 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 61 | 1759050 | 1759223 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 62 | 1586935 | 1587129 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 63 | 1812295 | 1812474 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 64 | 1804192 | 1804368 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 65 | 6853185 | 6853367 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 66 | 1819826 | 1820008 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 67 | 6880022 | 6880204 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 68 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 69 | 3957482 | 3957658 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 70 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 71 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 72 | 2315011 | 2315190 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 73 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 74 | 1554843 | 1555013 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 75 | 4068389 | 4068571 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 76 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 77 | 1916199 | 1916381 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 78 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 79 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 80 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 81 | 2580181 | 2580351 | + | NZ_CP026363.1 | Brevibacillus agri |
| 82 | 2370650 | 2370820 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 83 | 922348 | 922533 | - | NZ_CP024727.1 | Prevotella intermedia |
| 84 | 1112459 | 1112632 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 85 | 1406103 | 1406282 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 86 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 87 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 88 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 89 | 99725 | 99898 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 90 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 91 | 1810950 | 1811123 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 92 | 1679672 | 1679845 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 93 | 1702316 | 1702489 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 94 | 672019 | 672201 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 95 | 644575 | 644769 | + | NC_016024.1 | Chloracidobacterium thermophilum B |
| 96 | 714458 | 714634 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 97 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 98 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 99 | 10899374 | 10899562 | + | NZ_CP012333.1 | Labilithrix luteola |
| 100 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 101 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 102 | 4250446 | 4250622 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 103 | 2434069 | 2434242 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 104 | 1829739 | 1829921 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 105 | 371320 | 371505 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 106 | 3954645 | 3954833 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 107 | 1700206 | 1700379 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 108 | 538130 | 538309 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 109 | 819364 | 819549 | + | NZ_CP042806.1 | Terriglobus albidus |
| 110 | 2458486 | 2458671 | - | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 111 | 5583344 | 5583529 | - | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 112 | 2501011 | 2501193 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 113 | 1473534 | 1473707 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 114 | 1310958 | 1311131 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 115 | 2497257 | 2497442 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 116 | 3495914 | 3496099 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 117 | 643008 | 643193 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 118 | 4576322 | 4576507 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 119 | 691649 | 691834 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 120 | 2290765 | 2290950 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 121 | 7713185 | 7713367 | - | NZ_CP042914.1 | Roseimaritima ulvae |
| 122 | 1418001 | 1418177 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 123 | 1043147 | 1043323 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 124 | 286215 | 286391 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 125 | 990945 | 991130 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 126 | 1170976 | 1171155 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 127 | 2286089 | 2286268 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 128 | 82873 | 83049 | - | NZ_CP016033.1 | Erythrobacter neustonensis |
| 129 | 1136666 | 1136842 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 130 | 707314 | 707490 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 131 | 1498608 | 1498784 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 132 | 1295284 | 1295460 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 133 | 1614739 | 1614915 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 134 | 1349830 | 1350006 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 135 | 4836705 | 4836893 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 136 | 1927486 | 1927653 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 137 | 2214549 | 2214731 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 138 | 2389068 | 2389247 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 139 | 1647166 | 1647345 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 140 | 1836028 | 1836207 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 141 | 2505426 | 2505605 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 142 | 5263859 | 5264044 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 143 | 9247505 | 9247684 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 144 | 2516040 | 2516219 | - | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 145 | 155695 | 155895 | + | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 146 | 2948786 | 2948965 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 147 | 2232636 | 2232818 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 148 | 1542477 | 1542656 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 149 | 3020453 | 3020635 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 150 | 3399830 | 3400015 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 151 | 1936228 | 1936410 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 152 | 1425027 | 1425194 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 153 | 2453191 | 2453370 | - | NZ_CP036281.1 | Polystyrenella longa |
| 154 | 734820 | 735002 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 155 | 2068480 | 2068659 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 156 | 975209 | 975391 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 157 | 8810057 | 8810236 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 158 | 2452500 | 2452682 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 159 | 2045963 | 2046145 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 160 | 4333614 | 4333796 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 161 | 2082810 | 2082992 | + | NZ_CP029146.1 | Rhodococcus ruber |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030356.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.86 | 138 | 46.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
++ More..