Protein Information |
Information Type | Description |
---|---|
Protein name | Putative membrane protein insertion efficiency factor |
NCBI Accession ID | |
Organism | Salinibacter ruber (strain DSM 13855 / M31) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MRRALSLLARLPRLLLIGLVRLYQLVLSPHLGRTCRFHPTCSAYAIQAFREYGALKGLVLTVHRLLRCHPWGGHGYDPPRWFDEEHPAADGRPQAAEEQ |
Source of smORF | Swiss-Prot |
Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
Pubmed ID | 16330755 |
Domain | CDD:412414 |
Functional Category | Others |
Uniprot ID | Q2S3T2 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1300811 | 1301113 | - | NZ_CP030356.1 | Salinibacter ruber |
2 | 927371 | 927667 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
3 | 6871118 | 6871369 | - | NZ_CP043930.1 | Gimesia benthica |
4 | 1924310 | 1924597 | + | NZ_CP040882.1 | Sutterella faecalis |
5 | 826689 | 826946 | + | NZ_CP043575.1 | Comamonas koreensis |
6 | 5799230 | 5799475 | - | NZ_CP019236.1 | Rhodoferax koreense |
7 | 3061165 | 3061455 | - | NZ_CP041146.1 | Nocardioides humi |
8 | 1314435 | 1314677 | - | NZ_CP019437.1 | Thioclava nitratireducens |
9 | 1259799 | 1260041 | - | NZ_LR134365.1 | Cardiobacterium hominis |
10 | 1089566 | 1089808 | - | NZ_CP053562.1 | Thioclava electrotropha |
11 | 2681162 | 2681425 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
12 | 2875866 | 2876132 | - | NZ_CP016268.1 | Woeseia oceani |
13 | 2547286 | 2547531 | - | NZ_CP054619.1 | Azospirillum oryzae |
14 | 3103068 | 3103340 | + | NZ_CP010650.1 | Phaeobacter inhibens |
15 | 4279371 | 4279631 | - | NZ_CP048796.1 | Providencia vermicola |
16 | 3908213 | 3908479 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
17 | 4564821 | 4565078 | - | NZ_AP023184.1 | Buttiauxella agrestis |
18 | 5637460 | 5637813 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
19 | 4691231 | 4691488 | - | NZ_CP045845.1 | Kluyvera intermedia |
20 | 2825783 | 2826040 | - | NZ_CP049115.1 | Pantoea stewartii |
21 | 4028387 | 4028644 | - | NZ_CP034148.1 | Pantoea agglomerans |
22 | 4034663 | 4034920 | - | NZ_CP045720.1 | Pantoea eucalypti |
23 | 4048841 | 4049098 | - | NZ_CP038853.1 | Pantoea vagans |
24 | 4585146 | 4585403 | - | NC_017554.1 | Pantoea ananatis PA13 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00825.20 | 0.75 | 18 | -3.0 | same-strand | Ribonuclease P |
2 | PF00468.19 | 0.67 | 16 | 453.5 | same-strand | Ribosomal protein L34 |
3 | PF14849.8 | 0.71 | 17 | 3 | same-strand | YidC periplasmic domain |
4 | PF02096.22 | 0.83 | 20 | 3.0 | same-strand | 60Kd inner membrane protein |