Result : Q2S325
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000159.1 |
| Organism | Salinibacter ruber (strain DSM 13855 / M31) |
| Left | 1619807 |
| Right | 1620094 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGTGACCCGCGACGACGTTCGGCACGTTGCACAGCTTGCCCGGCTCGATTTTTCGGAGGAGGAAGAGGCCCGGATGGCGGAGGAGCTGAGCGAGATCCTCGGGTACGTGGAAAAACTCGATGAGCTCGACACCGCCGGGGTGCCGCCCATGTCCCACGTCCTGGACGTCACCAACGTCTTTCGGAGCGACGAGATTGAGGAGCGGATTGATCGGGGGCAGGCCCTGGAGCCGGCCCCGGACGCCGACAACGAACACTTCCTCGTCCCACAGGTGGTCGAGTAG |
| Sequence | MSVTRDDVRHVAQLARLDFSEEEEARMAEELSEILGYVEKLDELDTAGVPPMSHVLDVTNVFRSDEIEERIDRGQALEPAPDADNEHFLVPQVVE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 16330755 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q2S325 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1592152 | 1592439 | + | NZ_CP030356.1 | Salinibacter ruber |
| 2 | 646612 | 646899 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 3 | 137560 | 137829 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 4 | 1895410 | 1895694 | + | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 5 | 23821 | 24108 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 6 | 919751 | 920038 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 7 | 6212618 | 6212905 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 8 | 923529 | 923816 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 9 | 6879669 | 6879956 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 10 | 5929975 | 5930262 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 11 | 438888 | 439178 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 12 | 7170844 | 7171131 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 13 | 347543 | 347830 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 14 | 716158 | 716445 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 15 | 2251106 | 2251393 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 16 | 2301599 | 2301892 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 17 | 6801367 | 6801654 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 18 | 3153158 | 3153448 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 19 | 1675772 | 1676059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 20 | 5076980 | 5077267 | - | NZ_CP009288.1 | Paenibacillus durus |
| 21 | 204337 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 22 | 113395 | 113667 | + | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 23 | 2182815 | 2183099 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 24 | 4786412 | 4786699 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 25 | 3718972 | 3719259 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 26 | 5693287 | 5693574 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 27 | 3047483 | 3047770 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 28 | 6312360 | 6312647 | - | NZ_CP034437.1 | Paenibacillus albus |
| 29 | 4795478 | 4795765 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015672.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 0.83 | 24 | 27.5 | same-strand | Amidase |
| 2 | PF02934.17 | 0.72 | 21 | 1535 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.72 | 21 | 1535 | same-strand | GatB domain |
++ More..