Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP000230.1 |
Organism | Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) |
Left | 2065193 |
Right | 2065483 |
Strand | - |
Nucleotide Sequence | ATGGGTTTTTCAAGCATCTGGCATTGGATCATCGTTCTGGTCGTGGTTCTGCTGCTGTTCGGAGCGGGCAAGATTCCGCGGCTGATGGGCGATGTCGCCAAGGGCGTCAAGGCCTTCAAGAAAGGCATGGCGGACGATGAGGACGACGAGGCGGCCTCGGTTAGCGCCGAGCGTCGGGGGATCGAGGATGGCAAGCCCGCCCAGACCATTTATCCGCCCCAGCAGCCCCAACAGCCGCAGCAGCCGCCCCAGCAGCCGCCGGTCCACCGCGACGACGCTCCGCGGGGCTAA |
Sequence | MGFSSIWHWIIVLVVVLLLFGAGKIPRLMGDVAKGVKAFKKGMADDEDDEAASVSAERRGIEDGKPAQTIYPPQQPQQPQQPPQQPPVHRDDAPRG |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 21886856 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | Q2RTH2 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2065193 | 2065483 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
2 | 3540620 | 3540895 | + | NZ_CP039546.1 | Methylorubrum populi |
3 | 6257269 | 6257562 | - | NZ_CP029550.1 | Methylobacterium durans |
4 | 461997 | 462248 | + | NZ_CP029352.1 | Azospirillum thermophilum |
5 | 862299 | 862553 | + | NZ_CP054621.1 | Azospirillum oryzae |
6 | 2456291 | 2456533 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00902.20 | 1.0 | 6 | 593.5 | same-strand | Sec-independent protein translocase protein (TatC) |
2 | PF04079.18 | 0.67 | 4 | 145.5 | same-strand | Segregation and condensation complex subunit ScpB |
3 | PF00933.23 | 1.0 | 6 | 1914.0 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
4 | PF05036.15 | 1.0 | 6 | 2974.0 | same-strand | SPOR domain |