Result : Q2RTH2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000230.1 |
| Organism | Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) |
| Left | 2065193 |
| Right | 2065483 |
| Strand | - |
| Nucleotide Sequence | ATGGGTTTTTCAAGCATCTGGCATTGGATCATCGTTCTGGTCGTGGTTCTGCTGCTGTTCGGAGCGGGCAAGATTCCGCGGCTGATGGGCGATGTCGCCAAGGGCGTCAAGGCCTTCAAGAAAGGCATGGCGGACGATGAGGACGACGAGGCGGCCTCGGTTAGCGCCGAGCGTCGGGGGATCGAGGATGGCAAGCCCGCCCAGACCATTTATCCGCCCCAGCAGCCCCAACAGCCGCAGCAGCCGCCCCAGCAGCCGCCGGTCCACCGCGACGACGCTCCGCGGGGCTAA |
| Sequence | MGFSSIWHWIIVLVVVLLLFGAGKIPRLMGDVAKGVKAFKKGMADDEDDEAASVSAERRGIEDGKPAQTIYPPQQPQQPQQPPQQPPVHRDDAPRG |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 21886856 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q2RTH2 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2065193 | 2065483 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 2 | 3540620 | 3540895 | + | NZ_CP039546.1 | Methylorubrum populi |
| 3 | 6257269 | 6257562 | - | NZ_CP029550.1 | Methylobacterium durans |
| 4 | 461997 | 462248 | + | NZ_CP029352.1 | Azospirillum thermophilum |
| 5 | 862299 | 862553 | + | NZ_CP054621.1 | Azospirillum oryzae |
| 6 | 2456291 | 2456533 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017584.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 1.0 | 6 | 593.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 2 | PF04079.18 | 0.67 | 4 | 145.5 | same-strand | Segregation and condensation complex subunit ScpB |
| 3 | PF00933.23 | 1.0 | 6 | 1914.0 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 4 | PF05036.15 | 1.0 | 6 | 2974.0 | same-strand | SPOR domain |
++ More..