Result : Q2RQ23
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-870 beta chain (Antenna pigment protein beta chain) (LH-1) |
| NCBI Accession ID | M11801.1 |
| Organism | Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) |
| Left | 41 |
| Right | 250 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAAGTTAAGCAAGAAAGCCTCTCCGGGATTACCGAAGGAGAAGCCAAGGAATTTCACAAGATTTTCACGTCCAGCATCCTGGTGTTCTTTGGCGTCGCCGCCTTCGCTCACCTGCTGGTGTGGATCTGGCGTCCCTGGGTTCCGGGCCCGAACGGCTACTCGGCCCTCGAGACCCTGACTCAGACTCTGACCTACCTTTCTTAA |
| Sequence | MAEVKQESLSGITEGEAKEFHKIFTSSILVFFGVAAFAHLLVWIWRPWVPGPNGYSALETLTQTLTYLS |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 3001063 21886856 6434396 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | Q2RQ23 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3428133 | 3428342 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 2 | 1097341 | 1097559 | + | NZ_CP029553.1 | Methylobacterium terrae |
| 3 | 6685351 | 6685566 | - | NZ_CP029550.1 | Methylobacterium durans |
| 4 | 2424514 | 2424735 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 5 | 2833279 | 2833515 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 6 | 512894 | 513115 | - | NZ_CP025612.1 | Niveispirillum cyanobacteriorum |
| 7 | 5112950 | 5113168 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 8 | 2831493 | 2831723 | + | NZ_CP039546.1 | Methylorubrum populi |
| 9 | 1800007 | 1800198 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 10 | 5157848 | 5158066 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 11 | 1022100 | 1022324 | - | NZ_CP032509.1 | Georhizobium profundi |
| 12 | 1839993 | 1840205 | + | NZ_CP020083.1 | Blastomonas fulva |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029553.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00124.21 | 1.0 | 12 | 813.0 | same-strand | Photosynthetic reaction centre protein |
| 2 | PF00556.22 | 1.0 | 12 | 13.0 | same-strand | Antenna complex alpha/beta subunit |
| 3 | PF00148.21 | 1.0 | 12 | 1024.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 4 | PF08369.12 | 1.0 | 12 | 398.5 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 5 | PF00142.20 | 1.0 | 12 | 3421.0 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 6 | PF01656.25 | 1.0 | 12 | 3421.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 7 | PF02276.20 | 0.67 | 8 | 2180.0 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
++ More..