Result : Q2RM72
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | CP000232.1 |
| Organism | Moorella thermoacetica (strain ATCC 39073 / JCM 9320) |
| Left | 124051 |
| Right | 124347 |
| Strand | + |
| Nucleotide Sequence | ATGCGTAATTACGAAGTCGTCTTTGTAATTAGGCCCGACCTGGAAGCCGAAGCCACCACAGCAGTGGTAGAGAAATTTACCCAGCTGATCACCGACCAGGGTGGCCAGGTTACCAGGGTCGACCAATGGGGTAAAAAGCGGATGGCCTATGAAGTGCGCAAGTACCGGGAAGGTTATTACGTCCTGGTCGAGTTCAAAGGCACACCGGCCGTCGCCCAAGAATTAGAACGGGTGCTAAAAATTAGCGACGACGTTATTCGTTACCTCATTACACGCCTGGAAGAAGAGGCCAGCTAA |
| Sequence | MRNYEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYYVLVEFKGTPAVAQELERVLKISDDVIRYLITRLEEEAS |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 18631365 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2RM72 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 120857 | 121153 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 2 | 2907080 | 2907379 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 3 | 1709326 | 1709616 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 4 | 2566251 | 2566538 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 5 | 1071004 | 1071291 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 6 | 2768102 | 2768392 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 7 | 2528769 | 2529059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 8 | 4228358 | 4228648 | - | NZ_CP033433.1 | Cohnella candidum |
| 9 | 4532488 | 4532775 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 10 | 3950588 | 3950875 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 11 | 3607474 | 3607761 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 12 | 6018769 | 6019053 | - | NZ_CP009288.1 | Paenibacillus durus |
| 13 | 5398413 | 5398700 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 14 | 3589663 | 3589950 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 15 | 5251072 | 5251356 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 16 | 5836051 | 5836338 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 17 | 5259579 | 5259866 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 18 | 28382 | 28642 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 19 | 1896199 | 1896483 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 20 | 7150730 | 7151014 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 21 | 7044939 | 7045223 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 22 | 5643387 | 5643674 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 23 | 8141079 | 8141363 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 24 | 4294942 | 4295226 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 25 | 1559196 | 1559486 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 26 | 4212923 | 4213207 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 27 | 4253193 | 4253480 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 28 | 4304901 | 4305188 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 29 | 3765470 | 3765763 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 30 | 3154033 | 3154320 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 31 | 368755 | 369045 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 32 | 811117 | 811404 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 33 | 7903671 | 7903955 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 34 | 440866 | 441153 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 35 | 6477769 | 6478053 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 36 | 8803755 | 8804039 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 37 | 66038 | 66328 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 38 | 2514721 | 2515008 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 39 | 2766057 | 2766344 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 40 | 3239854 | 3240138 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 41 | 643357 | 643644 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 42 | 962517 | 962801 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 43 | 6796979 | 6797263 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 44 | 1043916 | 1044200 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 45 | 2741017 | 2741304 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 46 | 20856 | 21143 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 47 | 4005124 | 4005411 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 48 | 3246272 | 3246556 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 49 | 8084761 | 8085045 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 50 | 2247192 | 2247476 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 51 | 5672145 | 5672429 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 52 | 1582166 | 1582450 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 53 | 3797798 | 3798085 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 54 | 3369433 | 3369720 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 55 | 3391415 | 3391699 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 56 | 2700035 | 2700322 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 57 | 3641420 | 3641704 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 58 | 7040437 | 7040724 | - | NZ_AP019400.1 | Cohnella abietis |
| 59 | 165840 | 166124 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 60 | 3034078 | 3034362 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 61 | 383294 | 383578 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 62 | 359505 | 359789 | + | NZ_LR134375.1 | Veillonella dispar |
| 63 | 422679 | 422963 | + | NZ_LR778174.1 | Veillonella parvula |
| 64 | 775816 | 776100 | - | NZ_CP034437.1 | Paenibacillus albus |
| 65 | 5347241 | 5347525 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 66 | 104760 | 105029 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 67 | 2724951 | 2725238 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 68 | 422104 | 422388 | + | NZ_LT906470.1 | Veillonella rodentium |
| 69 | 797746 | 798012 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 70 | 1961119 | 1961409 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 71 | 530733 | 531023 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 72 | 2028106 | 2028396 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 73 | 708713 | 709003 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 74 | 653737 | 654027 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 75 | 2223317 | 2223607 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 76 | 2257031 | 2257315 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 77 | 1503689 | 1503955 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 78 | 1882722 | 1883012 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017237.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06107.13 | 0.67 | 52 | 1010.0 | same-strand | Bacterial protein of unknown function (DUF951) |
| 2 | PF00436.27 | 0.97 | 76 | 36.0 | same-strand | Single-strand binding protein family |
| 3 | PF01084.22 | 1.0 | 78 | 541.5 | same-strand | Ribosomal protein S18 |
++ More..