Result : Q2RL16
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000232.1 |
| Organism | Moorella thermoacetica (strain ATCC 39073 / JCM 9320) |
| Left | 565780 |
| Right | 566076 |
| Strand | + |
| Nucleotide Sequence | TTGCTGGAGTTTTTACTGCGCTTTTTTGGCCGTGATACCGCGAGCAGTAAGAAGGTAGCCAAAGAACGCCTGCGCCTGGTCCTGGTCCATGACCGGGCCGGGGTTTCCCCCCACCTTCTGGAATCCCTGAAGAACGATCTAATCAAGGTGATCTCGGAATACCTGGATATCGACACCGACGGGCTGGAGGTCAGCCTCACCCACGAGAATGACGCCGTGGCCCTGGTGGCCAATATCCCCATCCTGCGGGTGAAGCGCACCTTTAAAAGTGTCCAGGAGCCGGCCTTTAAGGTATGA |
| Sequence | MLEFLLRFFGRDTASSKKVAKERLRLVLVHDRAGVSPHLLESLKNDLIKVISEYLDIDTDGLEVSLTHENDAVALVANIPILRVKRTFKSVQEPAFKV |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 18631365 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q2RL16 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 487025 | 487321 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 2 | 1056151 | 1056426 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 3 | 2766608 | 2766886 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 4 | 2704106 | 2704372 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 5 | 3322310 | 3322591 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 6 | 2644185 | 2644472 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 7 | 1090783 | 1091058 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 8 | 3108435 | 3108710 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 9 | 4608304 | 4608579 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 10 | 3737916 | 3738191 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 11 | 2692359 | 2692628 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 12 | 3537109 | 3537384 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 13 | 440793 | 441071 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 14 | 4369032 | 4369304 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 15 | 3085512 | 3085796 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 16 | 1615602 | 1615880 | + | NZ_CP036259.1 | Sporomusa termitida |
| 17 | 1528670 | 1528951 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 18 | 4448723 | 4449001 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 19 | 302965 | 303246 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 20 | 198006 | 198284 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 21 | 636091 | 636363 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 22 | 5403118 | 5403375 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 23 | 477441 | 477713 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 24 | 418022 | 418300 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 25 | 668636 | 668926 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 26 | 1860913 | 1861185 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 27 | 1860876 | 1861163 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 28 | 2365144 | 2365425 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 29 | 735677 | 735958 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 30 | 1714090 | 1714368 | + | NZ_CP009687.1 | Clostridium aceticum |
| 31 | 1859305 | 1859580 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 32 | 1567110 | 1567391 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 33 | 2087142 | 2087426 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 34 | 1155391 | 1155672 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 35 | 715149 | 715415 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 36 | 3505256 | 3505540 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 37 | 1312673 | 1312957 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 38 | 1210165 | 1210449 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 39 | 626950 | 627216 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 40 | 2807415 | 2807699 | - | NZ_CP019870.1 | Clostridioides difficile |
| 41 | 3079523 | 3079807 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 42 | 1995699 | 1995974 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 43 | 897671 | 897937 | + | NC_008593.1 | Clostridium novyi NT |
| 44 | 3373066 | 3373332 | - | NC_014393.1 | Clostridium cellulovorans 743B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015589.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04085.16 | 0.89 | 39 | 4370 | same-strand | rod shape-determining protein MreC |
| 2 | PF00905.24 | 0.86 | 38 | 1675.5 | same-strand | Penicillin binding protein transpeptidase domain |
| 3 | PF03717.17 | 0.91 | 40 | 1678 | same-strand | Penicillin-binding Protein dimerisation domain |
| 4 | PF03775.18 | 1.0 | 44 | 854.0 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 5 | PF13614.8 | 1.0 | 44 | 19.0 | same-strand | AAA domain |
| 6 | PF01656.25 | 1.0 | 44 | 19.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 7 | PF10609.11 | 0.98 | 43 | 19 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 8 | PF01098.21 | 0.7 | 31 | 137 | same-strand | Cell cycle protein |
| 9 | PF01551.24 | 0.66 | 29 | 1536 | same-strand | Peptidase family M23 |
| 10 | PF04093.14 | 0.91 | 40 | 3889.0 | same-strand | rod shape-determining protein MreD |
++ More..