Result : Q2P8E4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein XOO0428 |
| NCBI Accession ID | AP008229.1 |
| Organism | Xanthomonas oryzae pv. oryzae (strain MAFF 311018) |
| Left | 460795 |
| Right | 461055 |
| Strand | + |
| Nucleotide Sequence | ATGCACGCCTACGTCTATAAAAGCCAACGCAAGCAGGACACCTTCGTCTATCTCGCCACGCGTGACGATTTCTCCGGTCTTCCTGCCGAAGTGCAGGCGCAGCTGGCGCCGTTTTCGTTCGTGCTGGAGGTGGCGTTGACGCCCGAGCGACGGCTGGCGCAGGCCGACGTGGCAACGGTGCGCGAGGCGCTGGGCAAGCACGGTTTCTATCTGCAATTGCCGAAAACACGCGTGCTCGCAGGCGAGTGCGACTATGACTGA |
| Sequence | MHAYVYKSQRKQDTFVYLATRDDFSGLPAEVQAQLAPFSFVLEVALTPERRLAQADVATVREALGKHGFYLQLPKTRVLAGECDYD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | Q2P8E4 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 337816 | 338076 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 2 | 2533048 | 2533308 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 3 | 4571261 | 4571521 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 4 | 4769768 | 4770028 | - | NZ_CP048044.1 | Xanthomonas citri |
| 5 | 4688779 | 4689039 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 6 | 3912512 | 3912772 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 7 | 315439 | 315699 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 8 | 3235984 | 3236244 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 9 | 4623160 | 4623420 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 10 | 3914552 | 3914827 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 11 | 945905 | 946177 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 12 | 4463306 | 4463566 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 13 | 1837423 | 1837692 | + | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 14 | 2749485 | 2749754 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 15 | 3503197 | 3503466 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 16 | 297177 | 297446 | + | NZ_CP046603.1 | Lysobacter soli |
| 17 | 478068 | 478325 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 18 | 3314829 | 3315083 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 19 | 329096 | 329353 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 20 | 5678188 | 5678457 | - | NZ_AP014940.1 | Lysobacter enzymogenes |
| 21 | 430883 | 431152 | + | NZ_CP029843.1 | Lysobacter maris |
| 22 | 1671725 | 1671994 | + | NZ_CP060711.1 | Thermomonas brevis |
| 23 | 2242747 | 2243007 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 24 | 180204 | 180464 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 25 | 2302137 | 2302409 | + | NZ_CP029556.1 | Lysobacter oculi |
| 26 | 4309665 | 4309925 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 27 | 5648710 | 5648982 | - | NZ_CP023465.1 | Lysobacter capsici |
| 28 | 1799320 | 1799592 | + | NZ_CP042218.1 | Luteimonas granuli |
| 29 | 3277103 | 3277348 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 30 | 3379581 | 3379817 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018725.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12796.9 | 0.93 | 28 | -7.0 | same-strand | Ankyrin repeats (3 copies) |
| 2 | PF13637.8 | 0.93 | 28 | -7.0 | same-strand | Ankyrin repeats (many copies) |
| 3 | PF13857.8 | 0.93 | 28 | -7.0 | same-strand | Ankyrin repeats (many copies) |
| 4 | PF00999.23 | 0.67 | 20 | 3664.0 | opposite-strand | Sodium/hydrogen exchanger family |
| 5 | PF02254.20 | 0.7 | 21 | 3670 | opposite-strand | TrkA-N domain |
++ More..