Result : Q2NKC3

Protein Information

• Protein name: 30S ribosomal protein S6
• NCBI Accession ID: CP000061.1
• Organism: Aster yellows witches'-broom phytoplasma (strain AYWB)
• Left: 3331
• Right: 3618
• Strand: +
• Nucleotide Sequence: ATGAAAAAATACGAAATAATGTATATTTTACGCCCCAATTTAGACAACAAATACGTTAAAAAAATTAATGATACTTTGCAAAATGTTTTTTTACAAGCCCCAAACCAAATTTTGGAACAAAAAGAAATAGGATTAAAAGACCTAACTTATTTTATTGATAATCATAAAAAAGGATATTACAATTGGTTAATGGTAAAAGCAGATAATGATGCTGTTTTAGAATTTAATCGTATTGTCAAAATTACTGAAGAAATTATTAGATTCATCGTTATTAAAGATAAAGAATAA
• Sequence: MKKYEIMYILRPNLDNKYVKKINDTLQNVFLQAPNQILEQKEIGLKDLTYFIDNHKKGYYNWLMVKADNDAVLEFNRIVKITEEIIRFIVIKDKE
• Source of smORF: Swiss-Prot
• Function: Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}.
• Pubmed ID: 16672622
• Domain: CDD:412366
• Functional Category: Ribosomal_protein
• Uniprot ID: Q2NKC3
• ORF Length (Amino Acid): 95

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1374891	1375178	-	NC_022538.1	Acholeplasma palmae J233
2	345748	346035	+	NC_022549.1	Acholeplasma brassicae
3	579134	579403	+	NZ_LR215048.1	Acholeplasma axanthum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_022538.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03796.17	0.67	2	3252.5	same-strand	DnaB-like helicase C terminal domain
2	PF00772.23	0.67	2	3252.5	same-strand	DnaB-like helicase N terminal domain
3	PF13481.8	0.67	2	3252.5	same-strand	AAA domain
4	PF03948.16	1.0	3	822	same-strand	Ribosomal protein L9, C-terminal domain
5	PF01368.22	1.0	3	822	same-strand	DHH family
6	PF01281.21	1.0	3	822	same-strand	Ribosomal protein L9, N-terminal domain
7	PF02272.21	1.0	3	822	same-strand	DHHA1 domain
8	PF01084.22	1.0	3	457	same-strand	Ribosomal protein S18
9	PF00436.27	1.0	3	4	same-strand	Single-strand binding protein family
10	PF02464.19	1.0	3	145	same-strand	Competence-damaged protein
11	PF13365.8	0.67	2	998.0	same-strand	Trypsin-like peptidase domain
12	PF01026.23	0.67	2	1889.5	same-strand	TatD related DNase
13	PF00009.29	0.67	2	3393	same-strand	Elongation factor Tu GTP binding domain
14	PF03143.19	0.67	2	2804.0	same-strand	Elongation factor Tu C-terminal domain
15	PF03144.27	0.67	2	3393	same-strand	Elongation factor Tu domain 2
16	PF01926.25	0.67	2	3393	same-strand	50S ribosome-binding GTPase