ProsmORF-pred
Result : Q2NIX2
Protein Information
Information Type Description
Protein name 50S ribosomal protein L30
NCBI Accession ID CP000061.1
Organism Aster yellows witches'-broom phytoplasma (strain AYWB)
Left 524026
Right 524223
Strand -
Nucleotide Sequence ATGAAATTAAAAATTACTCTTACCAAAAGTCTTATTGCTTGTCGTTTTAATCAAATTAAAACCGCTCACTGCCTAGGTTTAAAAAAAATTAACAATCAAGTTATTAAAGATGATACTCCAGCCATCCATGGAATGATTAAAACCATCAGTCATCTTGTTGTAGTTGAAAAAGTTTCTTATACAAAGGAGCAAAAATAA
Sequence MKLKITLTKSLIACRFNQIKTAHCLGLKKINNQVIKDDTPAIHGMIKTISHLVVVEKVSYTKEQK
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7.
Pubmed ID 16672622
Domain CDD:412218
Functional Category Ribosomal_protein
Uniprot ID Q2NIX2
ORF Length (Amino Acid) 65
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 248
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1445578 1445757 - NC_022538.1 Acholeplasma palmae J233
2 456592 456768 + NZ_LR215048.1 Acholeplasma axanthum
3 278932 279111 + NC_022549.1 Acholeplasma brassicae
4 92593 92766 + NC_010163.1 Acholeplasma laidlawii PG-8A
5 1540017 1540196 - NZ_CP070228.1 Arcanobacterium phocisimile
6 702887 703066 + NZ_LS483427.1 Arcanobacterium haemolyticum
7 138571 138753 + NZ_CP024848.1 Oceanobacillus zhaokaii
8 1827977 1828138 - NZ_LT906439.1 Streptococcus merionis
9 2954817 2954978 - NZ_CP045875.1 Heliorestis convoluta
10 114364 114525 + NZ_LS483343.1 Streptococcus ferus
11 82904 83065 + NZ_AP018400.1 Streptococcus ruminantium
12 1244016 1244201 + NC_011653.1 Thermosipho africanus TCF52B
13 878650 878811 + NZ_CP054015.1 Streptococcus gallolyticus
14 80057 80218 + NZ_CP039457.1 Streptococcus pasteurianus
15 404578 404760 + NZ_CP006950.1 Dehalococcoides mccartyi CG4
16 81670 81831 + NC_012924.1 Streptococcus suis SC84
17 3295825 3296007 - NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
18 94504 94665 + NZ_LS483383.1 Streptococcus cristatus ATCC 51100
19 973834 974001 + NZ_CP039291.1 Cellulomonas shaoxiangyii
20 2948690 2948857 - NC_014151.1 Cellulomonas flavigena DSM 20109
21 444137 444298 - NZ_CP032620.1 Streptococcus koreensis
22 963136 963303 + NZ_CP045529.1 Luteimicrobium xylanilyticum
23 701793 701960 + NC_013530.1 Xylanimonas cellulosilytica DSM 15894
24 3510601 3510768 + NZ_CP035495.1 Xylanimonas allomyrinae
25 1055201 1055383 - NZ_CP022315.1 Virgibacillus phasianinus
26 2373058 2373237 - NZ_CP023434.1 Suicoccus acidiformans
27 1755639 1755800 - NZ_LS483436.1 Streptococcus intermedius
28 2029754 2029915 - NZ_LR594049.1 Streptococcus gordonii
29 996951 997127 + NZ_CP007389.1 Thermosipho melanesiensis
30 1642796 1642981 + NZ_CP034248.1 Paenibacillus lentus
31 3913288 3913470 + NZ_CP017316.1 Streptomyces rubrolavendulae
32 4075180 4075362 + NZ_CP023696.1 Streptomyces fradiae ATCC 10745 = DSM 40063
33 3270243 3270425 - NZ_CP040752.1 Streptomyces rectiverticillatus
34 2576757 2576930 - NZ_CP041091.1 Nocardioides sambongensis
35 2797961 2798128 - NZ_CP051884.1 Cellulomonas taurus
36 1104896 1105081 + NZ_AP019004.1 Phascolarctobacterium faecium
37 2251723 2251902 + NZ_AP018449.1 Methylomusa anaerophila
38 4687620 4687802 + NZ_CP023695.1 Streptomyces alboniger
39 5996273 5996455 + NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
40 5622044 5622226 + NZ_CP023694.1 Streptomyces coeruleorubidus
41 6054271 6054453 + NZ_CP022744.1 Streptomyces lincolnensis
42 5734319 5734498 + NZ_CP023690.1 Streptomyces spectabilis
43 4150750 4150929 - NC_013929.1 Streptomyces scabiei 87.22
44 3627321 3627500 - NZ_CP033433.1 Cohnella candidum
45 677324 677485 + NZ_CP043405.1 Streptococcus ratti
46 70939 71100 + NZ_LS483403.1 Streptococcus lutetiensis
47 5606261 5606443 + NZ_CP022685.1 Streptomyces formicae
48 4163394 4163576 - NZ_CP023699.1 Streptomyces kanamyceticus
49 4289156 4289338 + NZ_CP029254.1 Streptomyces spongiicola
50 4061495 4061677 + NZ_CP029188.1 Streptomyces tirandamycinicus
51 2360532 2360717 + NZ_CP035807.1 Thiospirochaeta perfilievii
52 129483 129665 + NC_007530.2 Bacillus anthracis str. 'Ames Ancestor'
53 135128 135310 + NC_011725.1 Bacillus cereus B4264
54 2944865 2945050 - NZ_CP054614.1 Paenibacillus barcinonensis
55 852042 852203 + NZ_CP015196.1 Streptococcus marmotae
56 1006072 1006248 - NZ_LR215050.1 Acholeplasma hippikon
57 1283058 1283231 + NC_013947.1 Stackebrandtia nassauensis DSM 44728
58 4753310 4753492 + NZ_CP042266.1 Streptomyces qinzhouensis
59 1165111 1165272 - NZ_LR134341.1 Streptococcus pseudoporcinus
60 90340 90501 + NZ_CP031733.1 Streptococcus chenjunshii
61 2502050 2502229 + NZ_LN849456.1 Devriesea agamarum
62 4888845 4889027 + NZ_CP020700.1 Streptomyces tsukubensis
63 78857 79018 + NZ_LR594046.1 Streptococcus dysgalactiae
64 635359 635556 + NC_014165.1 Thermobispora bispora DSM 43833
65 4984506 4984688 - NZ_CP040336.1 Bacillus luti
66 134926 135108 + NZ_CP064875.1 Bacillus toyonensis
67 776672 776851 + NZ_CP064056.1 Staphylococcus lloydii
68 730042 730221 + NZ_LR134089.1 Staphylococcus saprophyticus
69 796735 796914 + NZ_CP008724.1 Staphylococcus xylosus
70 4903434 4903616 - NC_013510.1 Thermomonospora curvata DSM 43183
71 78377 78538 + NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
72 115504 115665 + NZ_CP025536.1 Streptococcus pluranimalium
73 499783 499944 - NZ_LR134293.1 Streptococcus canis
74 135792 135974 + NZ_CP024109.1 Bacillus cytotoxicus
75 63852 64013 + NZ_LR594050.1 Streptococcus porcinus
76 163978 164160 - NZ_CP022437.1 Virgibacillus necropolis
77 134847 135029 + NZ_CP032365.1 Bacillus wiedmannii
78 5209091 5209273 + NZ_CP023688.1 Streptomyces rimosus
79 3881868 3882050 + NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
80 1286618 1286797 + NZ_CP027770.1 Staphylococcus felis
81 721936 722103 - NC_015707.1 Pseudothermotoga thermarum DSM 5069
82 1479882 1480043 - NZ_CP014835.1 Streptococcus halotolerans
83 498159 498320 + NZ_CP022680.1 Streptococcus respiraculi
84 2458500 2458685 + NZ_CP053564.1 Pseudonocardia broussonetiae
85 4094153 4094332 - NZ_CP023689.1 Streptomyces chartreusis
86 1366348 1366530 - NZ_CP018622.1 Virgibacillus dokdonensis
87 3688868 3689050 + NZ_CP032229.1 Streptomyces seoulensis
88 4556109 4556291 + NZ_AP023439.1 Streptomyces tuirus
89 4473828 4474010 + NZ_CP029043.1 Streptomyces nigra
90 5091407 5091589 + NC_021985.1 Streptomyces collinus Tu 365
91 4771233 4771415 + NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
92 3656009 3656167 - NZ_CP051006.1 Streptomyces griseofuscus
93 5258637 5258819 + NZ_CP021978.1 Streptomyces hawaiiensis
94 5453171 5453353 + NZ_CP015098.1 Streptomyces qaidamensis
95 3960459 3960641 - NZ_CP030073.1 Streptomyces cadmiisoli
96 3937013 3937195 - NZ_CP032427.1 Streptomyces griseorubiginosus
97 9173844 9174026 - NZ_CP063373.1 Streptomyces ferrugineus
98 6605004 6605186 + NZ_CP045096.1 Streptomyces phaeolivaceus
99 6312428 6312610 + NZ_CP034463.1 Streptomyces aquilus
100 6070326 6070508 + NZ_CP034539.1 Streptomyces cyaneochromogenes
101 899557 899739 + NZ_CP016279.1 Streptomyces griseochromogenes
102 1412233 1412394 + NC_010337.2 Heliomicrobium modesticaldum Ice1
103 73291 73452 + NZ_CP010450.1 Streptococcus pyogenes
104 4303236 4303424 - NZ_CP009896.1 Pimelobacter simplex
105 3958801 3958983 - NZ_CP023691.1 Streptomyces platensis
106 2007634 2007816 - NC_006085.1 Cutibacterium acnes KPA171202
107 7510057 7510239 + NC_016582.1 Streptomyces bingchenggensis BCW-1
108 1853312 1853473 - NZ_LR134275.1 Streptococcus vestibularis
109 1835135 1835296 - NC_017581.1 Streptococcus thermophilus JIM 8232
110 84909 85067 + NZ_LR134512.1 Streptococcus agalactiae
111 2065163 2065345 - NC_007503.1 Carboxydothermus hydrogenoformans Z-2901
112 617658 617837 + NZ_CP065712.1 Staphylococcus auricularis
113 485928 486089 - NZ_CP016953.1 Streptococcus himalayensis
114 1747377 1747538 - NZ_LR134336.1 Streptococcus oralis ATCC 35037
115 2957 3118 + NZ_CP032621.1 Streptococcus gwangjuense
116 300122 300283 + NC_015875.1 Streptococcus pseudopneumoniae IS7493
117 2694997 2695176 + NZ_CP018199.1 Staphylococcus succinus
118 1516208 1516393 - NZ_LT906446.1 Megamonas hypermegale
119 686773 686958 + NC_007777.1 Frankia casuarinae
120 275396 275572 + NZ_LR134338.1 Brevibacillus brevis
121 4356282 4356464 + NZ_CP015866.1 Streptomyces parvulus
122 2814396 2814566 - NC_020134.1 Thermoclostridium stercorarium subsp. stercorarium DSM 8532
123 3475140 3475322 - NZ_CP072931.1 Streptomyces auratus AGR0001
124 3866403 3866585 - NZ_CP019457.1 Streptomyces lydicus
125 136607 136789 + NZ_CP024035.1 Priestia aryabhattai
126 2362741 2362929 + NZ_CP031092.1 Salicibibacter kimchii
127 1956883 1957044 - NC_008025.1 Deinococcus geothermalis DSM 11300
128 777276 777461 - NC_016641.1 Paenibacillus terrae HPL-003
129 1032518 1032703 - NZ_CP008796.1 Thermodesulfobacterium commune DSM 2178
130 1710606 1710767 - NZ_CP034543.1 Streptococcus periodonticum
131 1774964 1775125 - NZ_CP012805.1 Streptococcus anginosus
132 189046 189234 + NZ_CP029797.1 Paraliobacillus zengyii
133 244177 244341 + NC_008593.1 Clostridium novyi NT
134 852800 852958 - NZ_CP023392.1 Lactococcus raffinolactis
135 5681707 5681889 + NZ_AP023440.1 Streptomyces glomeroaurantiacus
136 2592523 2592702 - NC_013891.1 Listeria seeligeri serovar 1/2b str. SLCC3954
137 2718408 2718587 - NZ_CP009577.1 Listeria ivanovii subsp. ivanovii
138 2697267 2697446 - NC_003210.1 Listeria monocytogenes EGD-e
139 387160 387339 + NZ_CP011102.1 Listeria weihenstephanensis
140 392334 392513 - NZ_CP049886.1 Vagococcus coleopterorum
141 100159 100320 + NZ_CP029491.1 Streptococcus sobrinus
142 2174896 2175054 + NZ_CP014699.1 Streptococcus pantholopis
143 569087 569263 - NZ_LR134476.1 Trueperella bialowiezensis
144 2018314 2018493 + NZ_CP023671.1 Clostridium septicum
145 2309398 2309577 - NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
146 2072200 2072388 - NZ_CP035485.1 Salicibibacter halophilus
147 438666 438848 + NZ_CP017560.1 Sporosarcina ureilytica
148 2069714 2069896 - NZ_CP054938.1 Streptomyces harbinensis
149 1972433 1972612 - NZ_CP013114.1 Staphylococcus equorum
150 165037 165225 + NC_014829.1 Evansella cellulosilytica DSM 2522
151 2602841 2603020 - NZ_LT906444.1 Listeria welshimeri
152 2055351 2055530 - NZ_CP021874.1 Enterococcus wangshanyuanii
153 2432176 2432358 - NZ_CP017704.1 Peribacillus simplex NBRC 15720 = DSM 1321
154 2419603 2419761 - NZ_LR590481.1 Hathewaya histolytica
155 1484151 1484312 - NZ_CP014334.1 Fervidobacterium islandicum
156 5290675 5290851 - NZ_CP009288.1 Paenibacillus durus
157 1755707 1755895 + NZ_CP043611.1 Paenibacillus antarcticus
158 2983075 2983257 + NZ_CP038012.1 Sporosarcina pasteurii
159 222176 222334 + NC_011837.1 Clostridium kluyveri NBRC 12016
160 1343434 1343613 - NC_015318.1 Hippea maritima DSM 10411
161 1052258 1052437 - NZ_CP022096.2 Staphylococcus pettenkoferi
162 1908050 1908211 - NZ_AP014612.1 Streptococcus troglodytae
163 253657 253836 + NZ_CP027286.1 Clostridium chauvoei
164 221509 221685 - NZ_CP034437.1 Paenibacillus albus
165 228313 228504 + NC_010718.1 Natranaerobius thermophilus JW/NM-WN-LF
166 1757731 1757892 + NZ_CP013237.1 Streptococcus mutans
167 1777259 1777438 - NZ_CP013911.1 Staphylococcus haemolyticus
168 971541 971720 - NZ_CP071376.1 Clostridium gasigenes
169 1515096 1515275 + NZ_CP033732.1 Staphylococcus hominis
170 716328 716507 + NZ_LR134242.1 Staphylococcus warneri
171 754667 754846 - NC_022737.1 Staphylococcus pasteuri SP1
172 2163785 2163964 - NZ_LT906460.1 Staphylococcus simiae
173 2265257 2265436 - NZ_LR134304.1 Staphylococcus schweitzeri
174 1771625 1771804 - NZ_CP013988.1 Aerococcus urinaeequi
175 869273 869467 - NZ_CP060716.1 Leucobacter denitrificans
176 2581613 2581795 + NZ_CP030926.1 Peribacillus butanolivorans
177 2117303 2117482 - NZ_CP017267.1 Vagococcus teuberi
178 74995 75174 + NZ_CP023074.1 Enterococcus thailandicus
179 77697 77876 + NZ_CP065211.1 Enterococcus lactis
180 3070552 3070725 - NZ_CP048104.1 Kroppenstedtia pulmonis
181 431649 431828 + NZ_CP014164.1 Aerococcus viridans
182 32989 33150 - NZ_CP070872.1 Lactococcus taiwanensis
183 2240329 2240508 + NZ_CP014022.1 Staphylococcus lugdunensis
184 146889 147071 + NZ_CP012024.1 Bacillus smithii
185 565649 565828 + NZ_LT906462.1 Mammaliicoccus stepanovicii
186 482678 482857 + NZ_CP022046.2 Mammaliicoccus sciuri
187 1470291 1470473 - NZ_CP019728.1 Jeotgalibaca dankookensis
188 2348032 2348202 + NZ_CP009709.1 Weizmannia coagulans DSM 1 = ATCC 7050
189 281413 281589 - NZ_CP026363.1 Brevibacillus agri
190 5281008 5281187 - NZ_CP020953.1 Clostridium drakei
191 4643014 4643193 + NZ_CP009933.1 Clostridium scatologenes
192 1722090 1722269 - NZ_LT906464.1 Staphylococcus muscae
193 1671633 1671815 + NZ_CP049889.1 Jeotgalibaca porci
194 712614 712793 + NZ_CP008747.1 Staphylococcus hyicus
195 202222 202401 + NC_020291.1 Clostridium saccharoperbutylacetonicum N1-4(HMT)
196 3165955 3166134 + NZ_CP018061.1 Enterococcus mundtii
197 3669844 3670023 - NZ_CP028842.1 Clostridium botulinum
198 3950970 3951149 - NZ_CP011663.1 Clostridium sporogenes
199 274990 275169 + NZ_CP011366.1 Salinicoccus halodurans
200 4430638 4430817 - NZ_CP011803.1 Clostridium carboxidivorans P7
201 2593878 2594057 - NZ_LR134483.1 Listeria grayi
202 3343287 3343466 - NZ_CP040924.1 Clostridium thermarum
203 186526 186702 - NZ_CP046314.1 Gemella morbillorum
204 1763148 1763327 - NZ_CP045927.1 Staphylococcus agnetis
205 581987 582166 - NZ_CP023011.2 Enterococcus hirae
206 241724 241903 + NZ_CP017253.2 Clostridium taeniosporum
207 309793 309960 + NZ_CP029494.1 Deinococcus irradiatisoli
208 2795200 2795373 + NZ_CP011058.1 Paenibacillus beijingensis
209 1193576 1193752 - NZ_CP021904.1 Alkalitalea saponilacus
210 5082837 5083016 - NZ_CP042436.1 Mucilaginibacter ginsenosidivorans
211 155208 155390 + NZ_CP023704.1 Caldibacillus thermoamylovorans
212 236019 236207 - NC_018178.1 Melioribacter roseus P3M-2
213 2966411 2966584 - NC_008261.1 Clostridium perfringens ATCC 13124
214 3615911 3616093 - NZ_CP014167.1 Paenibacillus yonginensis
215 2148594 2148773 - NZ_CP012047.1 Tetragenococcus halophilus
216 77387 77566 + NZ_CP039712.1 Vagococcus zengguangii
217 3080005 3080166 - NZ_LN614827.1 Legionella fallonii LLAP-10
218 261205 261375 + NC_020995.1 Enterococcus casseliflavus EC20
219 2216852 2217010 - NC_022369.1 Lactococcus lactis subsp. cremoris KW2
220 199265 199444 + NZ_CP043998.1 Clostridium diolis
221 2426065 2426244 - NZ_AP022822.1 Enterococcus saigonensis
222 644800 644979 - NZ_CP020773.1 Staphylococcus lutrae
223 1973321 1973500 - NC_014925.1 Staphylococcus pseudintermedius HKU10-03
224 394523 394702 + NZ_CP019698.1 Desulfotomaculum ferrireducens
225 1662620 1662799 - NZ_CP068061.1 Mammaliicoccus vitulinus
226 750939 751097 - NZ_CP053988.1 Abiotrophia defectiva
227 312512 312691 + NC_015589.1 Desulfotomaculum ruminis DSM 2154
228 2873024 2873182 - NZ_CP014170.1 Clostridium tyrobutyricum
229 481339 481518 + NZ_AP024085.1 Faecalibacillus intestinalis
230 240417 240596 + NC_009253.1 Desulfotomaculum reducens MI-1
231 510500 510679 + NZ_CP016843.1 Carnobacterium divergens
232 1754743 1754919 - NZ_LR134484.1 Gemella haemolysans
233 3529796 3529975 - NZ_CP030775.1 Clostridium butyricum
234 2300503 2300682 - NC_014614.1 Acetoanaerobium sticklandii
235 3979808 3979987 - NZ_CP054139.1 Mucilaginibacter mali
236 840660 840839 + NZ_CP030848.1 Sphingobacterium hotanense
237 2741311 2741493 + NZ_LR130778.1 Petrocella atlantisensis
238 2366538 2366714 - NC_018664.1 Gottschalkia acidurici 9a
239 274908 275066 + NZ_CP032416.1 Clostridium fermenticellae
240 407156 407335 + NZ_CP025286.1 Ethanoligenens harbinense YUAN-3
241 6309284 6309460 - NZ_CP048209.1 Paenibacillus lycopersici
242 4226396 4226572 + NZ_CP048286.1 Paenibacillus rhizovicinus
243 4362283 4362456 - NZ_CP022657.1 Tumebacillus algifaecis
244 3550944 3551123 - NC_017770.1 Solitalea canadensis DSM 3403
245 287274 287453 + NZ_CP014204.2 Clostridium baratii
246 1621222 1621404 + NZ_CP048000.1 Anaerocolumna sedimenticola
247 770131 770289 + NZ_CP032364.1 Lachnoanaerobaculum umeaense
248 1995564 1995740 + NZ_CP007034.1 Barnesiella viscericola DSM 18177
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_022538.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01176.21 0.77 192 2886.5 same-strand Translation initiation factor 1A / IF-1
2 PF00406.24 0.93 230 1859.0 same-strand Adenylate kinase
3 PF13207.8 0.93 230 1859.0 same-strand AAA domain
4 PF05191.16 0.74 183 1830 same-strand Adenylate kinase, active site lid
5 PF13238.8 0.65 161 1891 same-strand AAA domain
6 PF13671.8 0.72 178 1945.5 same-strand AAA domain
7 PF00344.22 0.98 244 482.0 same-strand SecY
8 PF00828.21 0.99 246 23.0 same-strand Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
9 PF00333.22 1.0 248 14.0 same-strand Ribosomal protein S5, N-terminal domain
10 PF03719.17 1.0 248 14.0 same-strand Ribosomal protein S5, C-terminal domain
11 PF00861.24 1.0 248 547.0 same-strand Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
12 PF00347.25 1.0 248 965.0 same-strand Ribosomal protein L6
13 PF00410.21 1.0 248 1557.0 same-strand Ribosomal protein S8
14 PF00253.23 0.89 220 1989.0 same-strand Ribosomal protein S14p/S29e
++ More..