Result : Q2NIV6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000061.1 |
| Organism | Aster yellows witches'-broom phytoplasma (strain AYWB) |
| Left | 531026 |
| Right | 531316 |
| Strand | - |
| Nucleotide Sequence | ATGAATAAATACTATGATTTAGTTAAAGCACCAATCATTACTGAATTAACTAATAAATTGATCGAAAGACAAAATAAATACACCTTTAAAGTTGCCAAAACAGCTAATAAAGTAGAAATTAAAAAAGCTTTAGAAAGCATTTTCCAAGTTAAAGTTTTATCAGTTAACACTCGCAACGTTTTACCACAATTCAAAAGAAAAGGCAAATTTGAAGGTTATACTTCTGGTTATAAAAAAGCTATTTGTAAATTAGCTCCGGGACAAAAAATTAAAATCCTTGCTAATGAATAA |
| Sequence | MNKYYDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQFKRKGKFEGYTSGYKKAICKLAPGQKIKILANE |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 16672622 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2NIV6 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 128
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1452314 | 1452601 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 272202 | 272489 | + | NC_022549.1 | Acholeplasma brassicae |
| 3 | 449655 | 449942 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 4 | 1012849 | 1013085 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 5 | 85600 | 85836 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 6 | 2597336 | 2597632 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 7 | 471303 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 8 | 646232 | 646516 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 9 | 852175 | 852459 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 10 | 1239562 | 1239846 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 11 | 2132821 | 2133072 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 12 | 3187382 | 3187672 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 13 | 2244015 | 2244302 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 14 | 3537051 | 3537332 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 15 | 1097973 | 1098263 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 16 | 1129255 | 1129488 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 17 | 6435925 | 6436158 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 18 | 1151580 | 1151813 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 19 | 1640607 | 1640888 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 20 | 828432 | 828728 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 21 | 108312 | 108587 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 22 | 3996841 | 3997080 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 23 | 5465402 | 5465641 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 24 | 7400798 | 7401031 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 25 | 2621637 | 2621903 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 26 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 27 | 1405097 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 28 | 158118 | 158408 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 29 | 6157632 | 6157865 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 30 | 6282624 | 6282857 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 31 | 173125 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 32 | 728698 | 728937 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 33 | 2775225 | 2775458 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 34 | 1156579 | 1156875 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 35 | 3634291 | 3634566 | - | NZ_CP033433.1 | Cohnella candidum |
| 36 | 82879 | 83169 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 37 | 1810892 | 1811185 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 38 | 5624364 | 5624603 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 39 | 6145233 | 6145472 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 40 | 1554249 | 1554485 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 41 | 7136848 | 7137081 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 42 | 1483248 | 1483541 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 43 | 974998 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 44 | 6131390 | 6131623 | - | NZ_AP019400.1 | Cohnella abietis |
| 45 | 4690671 | 4690904 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 46 | 5297740 | 5297973 | - | NZ_CP009288.1 | Paenibacillus durus |
| 47 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 48 | 1038905 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 49 | 1146269 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 50 | 1819299 | 1819535 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 51 | 1216012 | 1216248 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 52 | 1813024 | 1813260 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 53 | 1003689 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 54 | 2403800 | 2404036 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 55 | 1288141 | 1288377 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 56 | 6464847 | 6465086 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 57 | 55507 | 55794 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 58 | 1933067 | 1933354 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 59 | 2607245 | 2607478 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 60 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 61 | 182026 | 182316 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 62 | 482113 | 482349 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 63 | 2961768 | 2962055 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 64 | 2665515 | 2665754 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 65 | 2307368 | 2307604 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 66 | 145411 | 145698 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 67 | 1069980 | 1070264 | - | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 68 | 3443591 | 3443881 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 69 | 2174185 | 2174418 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 70 | 1748665 | 1748898 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 71 | 129360 | 129596 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 72 | 2823012 | 2823248 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 73 | 143739 | 143975 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 74 | 2266765 | 2267001 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 75 | 1129090 | 1129377 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 76 | 1454127 | 1454414 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 77 | 1176392 | 1176676 | - | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 78 | 1942417 | 1942653 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 79 | 2013261 | 2013497 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 80 | 2292914 | 2293150 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 81 | 5135661 | 5135894 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 82 | 1061995 | 1062282 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 83 | 416040 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 84 | 3099158 | 3099394 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 85 | 246563 | 246799 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 86 | 410745 | 410981 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 87 | 3983768 | 3984001 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 88 | 1928339 | 1928626 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 89 | 1962648 | 1962884 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 90 | 348791 | 349027 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 91 | 585518 | 585754 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 92 | 5056 | 5301 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 93 | 3758050 | 3758289 | - | NC_014624.2 | Eubacterium callanderi |
| 94 | 2165340 | 2165579 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 95 | 1377887 | 1378126 | + | NZ_CP019962.1 | Eubacterium limosum |
| 96 | 1825868 | 1826101 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 97 | 228507 | 228797 | - | NZ_CP034437.1 | Paenibacillus albus |
| 98 | 1329021 | 1329305 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 99 | 4465579 | 4465818 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 100 | 6316268 | 6316558 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 101 | 1952522 | 1952761 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 102 | 860098 | 860337 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 103 | 223338 | 223577 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 104 | 1755135 | 1755419 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 105 | 2325907 | 2326203 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 106 | 2951911 | 2952144 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 107 | 405063 | 405308 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 108 | 514688 | 514975 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 109 | 1674261 | 1674548 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 110 | 566320 | 566607 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 111 | 427007 | 427294 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 112 | 1136707 | 1136994 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 113 | 1940357 | 1940647 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 114 | 4219291 | 4219581 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 115 | 1326913 | 1327149 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 116 | 314554 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 117 | 644975 | 645292 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 118 | 826517 | 826813 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 119 | 1134542 | 1134775 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 120 | 2503593 | 2503829 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 121 | 1276176 | 1276478 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 122 | 1000340 | 1000636 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 123 | 940206 | 940502 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 124 | 948568 | 948864 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 125 | 932218 | 932514 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 126 | 942047 | 942343 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 127 | 1295202 | 1295498 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 128 | 5478972 | 5479232 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022538.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.95 | 122 | 2259.0 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.98 | 125 | 1579 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.97 | 124 | 1579.0 | same-strand | KH domain |
| 4 | PF00237.21 | 0.98 | 125 | 1216 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 0.98 | 125 | 913 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 0.98 | 125 | 30 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 0.99 | 127 | 31 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 0.98 | 126 | 48.0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.94 | 120 | 1366.0 | same-strand | Ribosomal protein S10p/S20e |
++ More..