Result : Q2NIV1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000061.1 |
| Organism | Aster yellows witches'-broom phytoplasma (strain AYWB) |
| Left | 534166 |
| Right | 534372 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGTTCCTTTTAGACGCACCGGAAAAACGGCAAAAAGAAAAAGACGTACTCATTATAAGTTAAGTAATCCTGCTTTAGTACTTTGCAAAGAAACTAATGCTTTTACTTTGTCTCACAGAGTTACTAAAAATAGTGGTTATTACAAAGGAAAACTTATTTTAGAAAATAAACCTTCTAAAGCTCAAAAAACAACTGACAATTAA |
| Sequence | MAVPFRRTGKTAKRKRRTHYKLSNPALVLCKETNAFTLSHRVTKNSGYYKGKLILENKPSKAQKTTDN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16672622 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2NIV1 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 172
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 709464 | 709649 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 1343520 | 1343708 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 3 | 1339709 | 1339894 | - | NC_022549.1 | Acholeplasma brassicae |
| 4 | 1466409 | 1466582 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 5 | 2660917 | 2661090 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 6 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 7 | 937743 | 937916 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 8 | 3732798 | 3732971 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 9 | 861213 | 861389 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 10 | 1346892 | 1347065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 11 | 3848721 | 3848894 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 12 | 243753 | 243926 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 13 | 1661277 | 1661450 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 14 | 5057461 | 5057634 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 15 | 1961854 | 1962027 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 16 | 2023882 | 2024058 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 17 | 2046440 | 2046616 | - | NZ_CP016538.2 | Planococcus maritimus |
| 18 | 2069690 | 2069866 | - | NZ_CP059540.1 | Planococcus maritimus |
| 19 | 1842410 | 1842586 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 20 | 4133809 | 4133982 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 21 | 1046423 | 1046596 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 22 | 2660163 | 2660336 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 23 | 2183816 | 2183989 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 24 | 804911 | 805084 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 25 | 913722 | 913895 | + | NZ_CP047361.1 | Macrococcus canis |
| 26 | 985836 | 986009 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 27 | 2125539 | 2125712 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 28 | 2058901 | 2059074 | + | NZ_CP053989.1 | Niallia circulans |
| 29 | 2669166 | 2669339 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 30 | 3955403 | 3955576 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 31 | 2185942 | 2186118 | - | NZ_CP016540.2 | Planococcus versutus |
| 32 | 2171747 | 2171923 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 33 | 2276097 | 2276273 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 34 | 2942780 | 2942956 | + | NZ_CP013661.2 | Planococcus kocurii |
| 35 | 2320740 | 2320916 | - | NZ_CP019401.1 | Planococcus faecalis |
| 36 | 2462749 | 2462925 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 37 | 1570520 | 1570693 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 38 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 39 | 3814293 | 3814466 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 40 | 553148 | 553324 | - | NZ_CP046314.1 | Gemella morbillorum |
| 41 | 3948807 | 3948980 | - | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 4827568 | 4827741 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 43 | 315082 | 315273 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 44 | 1414933 | 1415106 | + | NZ_CP040336.1 | Bacillus luti |
| 45 | 3744933 | 3745106 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 46 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 47 | 368582 | 368758 | + | NZ_LR134484.1 | Gemella haemolysans |
| 48 | 2946506 | 2946682 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 49 | 587760 | 587933 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 50 | 2068362 | 2068535 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 51 | 1289509 | 1289682 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 52 | 225187 | 225360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 53 | 1474082 | 1474255 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 54 | 58177 | 58350 | - | NZ_CP043404.1 | Bacillus safensis |
| 55 | 1972044 | 1972217 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 56 | 822488 | 822661 | + | NZ_LR134483.1 | Listeria grayi |
| 57 | 2164210 | 2164389 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 58 | 1322379 | 1322555 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 59 | 2434069 | 2434242 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 60 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 61 | 1679672 | 1679845 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 62 | 1658346 | 1658519 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 63 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 64 | 2820684 | 2820857 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 65 | 1027570 | 1027749 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 66 | 2242608 | 2242781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 67 | 1702316 | 1702489 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 68 | 1038074 | 1038253 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 69 | 1931525 | 1931698 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 70 | 1343755 | 1343928 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 71 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 72 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 73 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 74 | 1804192 | 1804368 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 75 | 972241 | 972417 | - | NZ_CP013197.1 | Spiroplasma citri |
| 76 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 77 | 1039243 | 1039416 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 78 | 524702 | 524875 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 79 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 80 | 548946 | 549122 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 81 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 82 | 1700206 | 1700379 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 83 | 1748652 | 1748819 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 84 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 85 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 86 | 2471199 | 2471372 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 87 | 1927486 | 1927653 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 88 | 813582 | 813761 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 89 | 3370820 | 3370993 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 90 | 3926996 | 3927187 | + | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 91 | 1718848 | 1719021 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 92 | 3419714 | 3419890 | + | NZ_CP021434.1 | Tumebacillus avium |
| 93 | 1311921 | 1312097 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 94 | 2474162 | 2474335 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 95 | 1453976 | 1454152 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 96 | 4553645 | 4553818 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 97 | 1696022 | 1696195 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 98 | 2284769 | 2284942 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 99 | 1879593 | 1879766 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 100 | 430308 | 430487 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 101 | 3488121 | 3488294 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 102 | 1178578 | 1178751 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 103 | 4077467 | 4077640 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 104 | 590274 | 590465 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 105 | 725564 | 725740 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 106 | 719224 | 719400 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 107 | 1411660 | 1411833 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 108 | 433997 | 434170 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 109 | 797674 | 797847 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 110 | 1725429 | 1725602 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 111 | 651573 | 651746 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 112 | 1091134 | 1091307 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 113 | 99725 | 99898 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 114 | 190854 | 191027 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 115 | 1618210 | 1618383 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 116 | 1759050 | 1759223 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 117 | 957618 | 957791 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 118 | 1028027 | 1028200 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 119 | 930365 | 930538 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 120 | 785250 | 785423 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 121 | 1117535 | 1117717 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 122 | 750013 | 750195 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 123 | 824255 | 824437 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 124 | 406708 | 406887 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 125 | 761270 | 761461 | + | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 126 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 127 | 1554843 | 1555013 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 128 | 684832 | 685008 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 129 | 712718 | 712894 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 130 | 825447 | 825623 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 131 | 1343599 | 1343772 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 132 | 2588071 | 2588244 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 133 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 134 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 135 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 136 | 1889422 | 1889595 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 137 | 1810950 | 1811123 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 138 | 3571920 | 3572093 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 139 | 3716261 | 3716452 | - | NZ_CP030848.1 | Sphingobacterium hotanense |
| 140 | 1556094 | 1556270 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 141 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 142 | 1644357 | 1644530 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 143 | 1588058 | 1588231 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 144 | 491098 | 491268 | + | NZ_LT906444.1 | Listeria welshimeri |
| 145 | 944850 | 945026 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 146 | 521601 | 521771 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 147 | 1206918 | 1207097 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 148 | 6400738 | 6400911 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 149 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 150 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 151 | 610996 | 611187 | - | NZ_CP038029.1 | Sphingobacterium psychroaquaticum |
| 152 | 681086 | 681277 | - | NZ_LR590470.1 | Sphingobacterium daejeonense |
| 153 | 441333 | 441512 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 154 | 1770767 | 1770940 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 155 | 2548213 | 2548392 | - | NZ_CP023011.2 | Enterococcus hirae |
| 156 | 2377073 | 2377255 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 157 | 2033659 | 2033841 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 158 | 1312498 | 1312677 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 159 | 1821893 | 1822072 | - | NZ_CP065211.1 | Enterococcus lactis |
| 160 | 811634 | 811813 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 161 | 3362575 | 3362748 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 162 | 2709716 | 2709889 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 163 | 1284673 | 1284861 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 164 | 1141955 | 1142140 | - | NZ_CP018809.1 | Lactobacillus jensenii |
| 165 | 735625 | 735816 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 166 | 1488269 | 1488454 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 167 | 2299250 | 2299426 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 168 | 753690 | 753878 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 169 | 927145 | 927333 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 170 | 1183277 | 1183465 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 171 | 1810654 | 1810827 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 172 | 1735054 | 1735227 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 173 | 868472 | 868645 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009416.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.87 | 149 | 52.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 2 | PF05636.13 | 0.73 | 125 | 754.0 | opposite-strand | HIGH Nucleotidyl Transferase |
++ More..