Result : Q2NIP1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S15 |
| NCBI Accession ID | CP000061.1 |
| Organism | Aster yellows witches'-broom phytoplasma (strain AYWB) |
| Left | 606843 |
| Right | 607067 |
| Strand | - |
| Nucleotide Sequence | GTGGCATTAACCAAAGAACAAAAACAAGAAATCATTAAACAAAATTCACATTTTGCAAAAGATACAGGTTCATCTGAAGTTCAAATTGCTATTTTATCAGCAGAAATCAAACAATTAAGTGAACATTTAAAACAACATCCTCATGATTTTCACTCTAAAAGGGGTTTGTTTATGAAAAACAGCAAAAGACGTAATTTAGTAAAATATTTAGCAAACCAAAATTAA |
| Sequence | MALTKEQKQEIIKQNSHFAKDTGSSEVQIAILSAEIKQLSEHLKQHPHDFHSKRGLFMKNSKRRNLVKYLANQN |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}. |
| Pubmed ID | 16672622 |
| Domain | CDD:412325 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2NIP1 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 856995 | 857231 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 2 | 1287596 | 1287862 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 3 | 1210374 | 1210610 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 4 | 1478232 | 1478468 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 5 | 1946537 | 1946800 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 6 | 1652146 | 1652382 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 7 | 1719696 | 1719959 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 8 | 1450604 | 1450840 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 9 | 82959 | 83222 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 10 | 66217 | 66471 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 11 | 690460 | 690726 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 12 | 847604 | 847870 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 13 | 345232 | 345495 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 14 | 277795 | 278049 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 15 | 2021720 | 2021956 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 16 | 1361080 | 1361343 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 17 | 1063658 | 1063924 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 18 | 788493 | 788759 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 19 | 96281 | 96547 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 20 | 1480625 | 1480861 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 21 | 2046360 | 2046614 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 22 | 1493985 | 1494251 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 23 | 3658631 | 3658897 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 24 | 2003715 | 2003969 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 25 | 1476021 | 1476284 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 26 | 1656901 | 1657164 | - | NZ_CP014204.2 | Clostridium baratii |
| 27 | 1320048 | 1320314 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 28 | 946790 | 947056 | + | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 29 | 1140338 | 1140601 | - | NZ_CP016786.1 | Clostridium isatidis |
| 30 | 1575490 | 1575756 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 31 | 1775799 | 1776065 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 32 | 4538935 | 4539198 | + | NZ_CP023344.1 | Nibricoccus aquaticus |
| 33 | 156195 | 156458 | - | NZ_CP023671.1 | Clostridium septicum |
| 34 | 1312120 | 1312383 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 35 | 1871768 | 1872022 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 36 | 1424888 | 1425154 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 37 | 1564454 | 1564711 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 38 | 3614532 | 3614792 | - | NZ_AP014940.1 | Lysobacter enzymogenes |
| 39 | 1421179 | 1421445 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 40 | 1087627 | 1087890 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 41 | 1215750 | 1216013 | + | NZ_CP020953.1 | Clostridium drakei |
| 42 | 3052118 | 3052381 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 43 | 1412558 | 1412824 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 44 | 1415667 | 1415930 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 45 | 1692960 | 1693226 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 46 | 1232959 | 1233222 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 47 | 1696140 | 1696400 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 48 | 3830380 | 3830646 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 49 | 2317811 | 2318074 | - | NZ_CP016094.1 | Lacunisphaera limnophila |
| 50 | 1346015 | 1346281 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 51 | 1476395 | 1476658 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 52 | 1772277 | 1772540 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 53 | 706864 | 707127 | + | NZ_AP019829.2 | Leptotrichia wadei |
| 54 | 1300680 | 1300946 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 55 | 863613 | 863858 | + | NZ_LT906470.1 | Veillonella rodentium |
| 56 | 610205 | 610471 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 57 | 827957 | 828211 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 58 | 657417 | 657683 | + | NZ_CP009761.1 | Parvimonas micra |
| 59 | 2634223 | 2634480 | - | NZ_CP019870.1 | Clostridioides difficile |
| 60 | 2088284 | 2088544 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 61 | 765526 | 765792 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 62 | 898450 | 898716 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 63 | 531338 | 531577 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 64 | 709735 | 709998 | + | NZ_CP029256.1 | Christensenella minuta |
| 65 | 1510208 | 1510474 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019711.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01138.23 | 0.82 | 53 | 113 | same-strand | 3' exoribonuclease family, domain 1 |
| 2 | PF03725.17 | 0.82 | 53 | 113 | same-strand | 3' exoribonuclease family, domain 2 |
| 3 | PF00575.25 | 0.82 | 53 | 131 | same-strand | S1 RNA binding domain |
| 4 | PF03726.16 | 0.78 | 51 | 114 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
| 5 | PF00013.31 | 0.8 | 52 | 111.5 | same-strand | KH domain |
++ More..