Result : Q2NIG9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein (ACP) |
| NCBI Accession ID | CP000061.1 |
| Organism | Aster yellows witches'-broom phytoplasma (strain AYWB) |
| Left | 688200 |
| Right | 688430 |
| Strand | - |
| Nucleotide Sequence | ATGATTTTTGAGAAAATTAAAGATTTAATTGCCACCCAATTATCTTTAGATACTTCTACAATTACTTTAGACACCCGTTTTAAAGAAGATTTAGGACTTGATTCACTTGACGCTTTAGAACTAGTTATGGAAGCAGAAAAAACATTTCAAATCAACATTAGTGATGCAACTTTACAAAATTTCAAAACTGTTCAAGATATCGTTTTTTACATAACCAAAAACACCTCTTAA |
| Sequence | MIFEKIKDLIATQLSLDTSTITLDTRFKEDLGLDSLDALELVMEAEKTFQINISDATLQNFKTVQDIVFYITKNTS |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01217}. |
| Pubmed ID | 16672622 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q2NIG9 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 415559 | 415789 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 801672 | 801911 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 3 | 236678 | 236908 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 4 | 972552 | 972749 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 5 | 2554074 | 2554301 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 6 | 2383193 | 2383378 | - | NZ_CP038452.1 | Thermus caldilimi |
| 7 | 617187 | 617372 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 8 | 2328068 | 2328295 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 9 | 1865028 | 1865240 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
++ More..