Result : Q2ND30
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000157.1 |
| Organism | Erythrobacter litoralis (strain HTCC2594) |
| Left | 362591 |
| Right | 362833 |
| Strand | + |
| Nucleotide Sequence | ATGGGACAGATTGGTATTTGGCAAATCCTGATTATCGCACTGGTAATCCTCGTGCTCTTCGGGCGCGGGAAGATCAGCGACATGATGGGCGATTTCGGCAAGGGCGTATCCAGCTTCAAGAAGGGGCTGAACGAGGAAGACAAGCCTGCCGAACCGGCCGCCAAGATCGAAGGCCCCAGCCACGAAGCCAAGCCCGCCGGCGAGGCGGCCAAGGACCCACGGCCTGCCGACAAGCAGGGCTAG |
| Sequence | MGQIGIWQILIIALVILVLFGRGKISDMMGDFGKGVSSFKKGLNEEDKPAEPAAKIEGPSHEAKPAGEAAKDPRPADKQG |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 19168610 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q2ND30 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1849915 | 1850166 | - | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 2 | 419889 | 420101 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 3 | 2330338 | 2330601 | - | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 4 | 2508848 | 2509093 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 5 | 2516297 | 2516533 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 6 | 1433103 | 1433318 | - | NZ_CP011452.2 | Croceibacterium atlanticum |
| 7 | 2356704 | 2356928 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 8 | 1263661 | 1263891 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 9 | 1102366 | 1102593 | + | NZ_AP019389.1 | Qipengyuania flava |
| 10 | 304995 | 305225 | - | NZ_CP053921.1 | Erythrobacter mangrovi |
| 11 | 238286 | 238531 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 12 | 435560 | 435763 | - | NZ_CP046908.1 | Stappia indica |
| 13 | 3193433 | 3193663 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 14 | 3974827 | 3975060 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 15 | 5196799 | 5197032 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 16 | 2852684 | 2852950 | - | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 17 | 3912480 | 3912683 | - | NZ_CP010803.1 | Martelella endophytica |
| 18 | 2784151 | 2784357 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 19 | 790384 | 790614 | - | NZ_CP024920.1 | Qipengyuania seohaensis |
| 20 | 1987530 | 1987757 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 21 | 15011 | 15241 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 22 | 1091851 | 1092087 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 23 | 1708061 | 1708267 | + | NZ_CP041238.1 | Ensifer mexicanus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012669.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 1.0 | 23 | 484 | same-strand | Sec-independent protein translocase protein (TatC) |
| 2 | PF04079.18 | 0.96 | 22 | 78.5 | same-strand | Segregation and condensation complex subunit ScpB |
| 3 | PF00933.23 | 0.96 | 22 | 1542.0 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 4 | PF05036.15 | 0.87 | 20 | 2686.5 | same-strand | SPOR domain |
| 5 | PF05746.17 | 0.61 | 14 | 3356.0 | same-strand | DALR anticodon binding domain |
++ More..