Result : Q2MHT0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein MG141.1 |
| NCBI Accession ID | L43967.2 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Left | 180746 |
| Right | 181018 |
| Strand | + |
| Nucleotide Sequence | ATGCAACTAATAACAAGACTTTGTTTATTAACAAGAAAACATTTTGTTAAAAGAGAACTTTTACGTCTTGTAAAATTAGACAACCAACTTGAAATTGATCTTAATCAAAATCTCAAGGGCAGGGGTTATTATTTGAGTGTTTTTGGTTTAAAGCTAGATAAAAAACACCTCAAAGCTGTAGTTGAAAAACACCTTAAGGTTAGTTGTAATGATGCAAAGCTTACTGCAATGATTACCGCCTTACAACAATTAGCACAAGATGAAAAAAAATAG |
| Sequence | MQLITRLCLLTRKHFVKRELLRLVKLDNQLEIDLNQNLKGRGYYLSVFGLKLDKKHLKAVVEKHLKVSCNDAKLTAMITALQQLAQDEKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00189. Profile Description: N/A. Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation |
| Pubmed ID | 7569993 |
| Domain | CDD:412207 |
| Functional Category | Others |
| Uniprot ID | Q2MHT0 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 180746 | 181018 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 205751 | 206020 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000908.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08529.13 | 1.0 | 2 | 969.5 | same-strand | NusA N-terminal domain |
| 2 | PF00009.29 | 1.0 | 2 | -13.0 | same-strand | Elongation factor Tu GTP binding domain |
| 3 | PF11987.10 | 1.0 | 2 | -13.0 | same-strand | Translation-initiation factor 2 |
| 4 | PF01926.25 | 1.0 | 2 | -13.0 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF04760.17 | 1.0 | 2 | -13.0 | same-strand | Translation initiation factor IF-2, N-terminal region |
| 6 | PF00025.23 | 1.0 | 2 | -13.0 | same-strand | ADP-ribosylation factor family |
| 7 | PF08477.15 | 1.0 | 2 | -13.0 | same-strand | Ras of Complex, Roc, domain of DAPkinase |
| 8 | PF02033.20 | 1.0 | 2 | 1838.0 | same-strand | Ribosome-binding factor A |
++ More..