Result : Q2LUA0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 1858566 |
| Right | 1858805 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAAGAAAAATTTGAAGAAGCAATGGCCAAACTGGAAGCCCTGGTCCGAAAAATGGAAACAGGTGATATGACCCTTGAAGAATCCCTGAAGGCCTTCGAAGAAGGCATCAGACTTTCACGGCTGTGTGCGTCCCGCCTGGATGATGCCGAACGGCGCGTGGAGATGTTGATTGCTGAAAATTCGAATGTGACGGTGCAGCCCTTACGGGAAAATGGAGAGAAAAATGAATCCTGA |
| Sequence | MAKEKFEEAMAKLEALVRKMETGDMTLEESLKAFEEGIRLSRLCASRLDDAERRVEMLIAENSNVTVQPLRENGEKNES |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 17442750 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q2LUA0 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1858566 | 1858805 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 3324064 | 3324291 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 3 | 1453142 | 1453369 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 4 | 3351201 | 3351395 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 5 | 4250373 | 4250567 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 6 | 420153 | 420353 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 7 | 2168984 | 2169220 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 8 | 861520 | 861750 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 9 | 1031231 | 1031482 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 10 | 1915750 | 1915956 | - | NC_015676.1 | Methanosalsum zhilinae DSM 4017 |
| 11 | 2891853 | 2892083 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 12 | 2537866 | 2538096 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 13 | 2183686 | 2183928 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007759.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 0.92 | 12 | 12.0 | same-strand | Polyprenyl synthetase |
| 2 | PF13292.8 | 0.85 | 11 | 967 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 0.92 | 12 | 952.5 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.92 | 12 | 952.5 | same-strand | Transketolase, C-terminal domain |
++ More..