Result : Q2LTM9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 1616022 |
| Right | 1616312 |
| Strand | - |
| Nucleotide Sequence | ATGATGAAGCGTGTTCATGTTTACGTGAAAGGAAAGGTTCAGGGAGTATTTTTCCGTGCCCATACACGCAAGGCAGCCTTGCGATTCCACGTCAACGGCTGGGTCAGAAATCTTCCCAATGGTCGGGTAGAGGCTGTTTTTGAAGGAAGATCTCCGGAGGTCAATGCCCTGATTGACTGGTGCCGCCAGGGACCCTCTCATGCCATTGTGGAACATCTGGATGTTTGTGAGGAAACGTATACTGGAGAATTTGACGACTTCCGCATCCTATACGACGAGAGAGCATCATGA |
| Sequence | MMKRVHVYVKGKVQGVFFRAHTRKAALRFHVNGWVRNLPNGRVEAVFEGRSPEVNALIDWCRQGPSHAIVEHLDVCEETYTGEFDDFRILYDERAS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17442750 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q2LTM9 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1616022 | 1616312 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 1717367 | 1717639 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 3 | 1956989 | 1957225 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 4 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 5 | 301217 | 301489 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 6 | 591286 | 591564 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 7 | 1537927 | 1538202 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 8 | 1569939 | 1570211 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 9 | 1501642 | 1501881 | - | NZ_LT981265.1 | Candidatus Nitrosocaldus cavascurensis |
| 10 | 212486 | 212725 | + | NZ_CP024014.1 | Candidatus Nitrosocaldus islandicus |
| 11 | 4197205 | 4197444 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 12 | 598503 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 13 | 753404 | 753682 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 14 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 15 | 1979078 | 1979326 | + | NZ_CP007536.1 | Nitrososphaera viennensis EN76 |
| 16 | 2661318 | 2661569 | - | NZ_CP007174.1 | Candidatus Nitrososphaera evergladensis SR1 |
| 17 | 523638 | 523877 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 18 | 990845 | 991078 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 19 | 2408913 | 2409197 | - | NC_018719.1 | Candidatus Nitrososphaera gargensis Ga9.2 |
| 20 | 3390389 | 3390682 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 21 | 651242 | 651499 | + | NC_015315.1 | Thermoproteus uzoniensis 768-20 |
| 22 | 296394 | 296666 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 23 | 1299272 | 1299553 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 24 | 2089295 | 2089534 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 25 | 955028 | 955306 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 26 | 6198556 | 6198795 | - | NZ_CP061799.1 | Desulfonema limicola |
| 27 | 463774 | 464055 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 28 | 2595313 | 2595552 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 29 | 2511036 | 2511311 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 30 | 2794374 | 2794637 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 31 | 3212288 | 3212566 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 32 | 1792169 | 1792408 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 33 | 224323 | 224610 | + | NC_010525.1 | Pyrobaculum neutrophilum V24Sta |
| 34 | 1447005 | 1447325 | + | NZ_CP013011.1 | Pyrodictium delaneyi |
| 35 | 723713 | 723994 | + | NC_003364.1 | Pyrobaculum aerophilum str. IM2 |
| 36 | 263125 | 263406 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 37 | 1119675 | 1119938 | + | NC_017461.1 | Fervidicoccus fontis Kam940 |
| 38 | 893046 | 893318 | - | NZ_CP009961.1 | Infirmifilum uzonense |
| 39 | 93966 | 94247 | + | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 40 | 2167134 | 2167415 | + | NC_016645.1 | Pyrobaculum ferrireducens |
| 41 | 1008969 | 1009202 | + | NC_000854.2 | Aeropyrum pernix K1 |
| 42 | 2148289 | 2148543 | + | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 43 | 1130966 | 1131232 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 44 | 754834 | 755112 | + | NC_009073.1 | Pyrobaculum calidifontis JCM 11548 |
| 45 | 982664 | 982924 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 46 | 712037 | 712318 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 47 | 1279029 | 1279313 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 48 | 1297338 | 1297622 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 49 | 1553947 | 1554201 | - | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 50 | 2068781 | 2069065 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 51 | 442095 | 442328 | + | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 52 | 1641433 | 1641711 | - | NZ_CP019327.1 | Haloterrigena daqingensis |
| 53 | 453127 | 453366 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 54 | 1566786 | 1567025 | + | NZ_CP062310.1 | Infirmifilum lucidum |
| 55 | 2815366 | 2815602 | + | NZ_AP017558.1 | Halopenitus persicus |
| 56 | 928066 | 928320 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 57 | 662594 | 662872 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 58 | 1234749 | 1235015 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 59 | 800190 | 800468 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 60 | 2301379 | 2301657 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 61 | 1143092 | 1143328 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 62 | 1087210 | 1087458 | + | NZ_CP082286.1 | Halobaculum roseum |
| 63 | 3069271 | 3069537 | - | NZ_CP034345.1 | Haloplanus rallus |
| 64 | 1173076 | 1173363 | - | NC_008701.1 | Pyrobaculum islandicum DSM 4184 |
| 65 | 2030323 | 2030571 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 66 | 1329007 | 1329285 | + | NC_019974.1 | Natronococcus occultus SP4 |
| 67 | 1756618 | 1756854 | - | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 68 | 2558515 | 2558781 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 69 | 1059461 | 1059736 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 70 | 1687019 | 1687294 | - | NC_014537.1 | Vulcanisaeta distributa DSM 14429 |
| 71 | 260265 | 260540 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 72 | 2101766 | 2102044 | - | NZ_CP031115.1 | Rubrobacter indicoceani |
| 73 | 296279 | 296533 | + | NZ_CP058335.1 | Natronomonas salina |
| 74 | 4036009 | 4036308 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 75 | 642080 | 642334 | + | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 76 | 413589 | 413867 | - | NZ_CP071463.1 | Haloterrigena longa |
| 77 | 957392 | 957667 | + | NC_022521.1 | Aeropyrum camini SY1 = JCM 12091 |
| 78 | 6477769 | 6478020 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 79 | 134199 | 134435 | + | NZ_CP060717.1 | Sphingomonas rhizophila |
| 80 | 5275916 | 5276194 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 81 | 3016531 | 3016785 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 82 | 6972539 | 6972805 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 83 | 205696 | 205932 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 84 | 2073669 | 2073947 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 85 | 2617889 | 2618167 | - | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 86 | 3357232 | 3357510 | - | NZ_CP069188.1 | Haloterrigena salifodinae |
| 87 | 4130134 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 88 | 7675965 | 7676249 | + | NZ_CP023691.1 | Streptomyces platensis |
| 89 | 1809388 | 1809669 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 90 | 2441747 | 2442016 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 91 | 927972 | 928247 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
++ More..