Result : Q2LT33
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 1378361 |
| Right | 1378600 |
| Strand | + |
| Nucleotide Sequence | ATGCTCATCCTGACAAGGAAGTTGGGAGAATCCATCGTAATAGGCGATCAGATACAAATTACCCTTCTGGATATTAAAGGAAAACATGTCCGTATCGGTGTCAATGCGCCTAAAGGCATTGCCGTCCATCGTGGTGAAGTATATGAAATGATACAGGATGAAAACAAAAAGGCCTTTGAATCCGACGTTAAAAACAGTGAGATGCTGTCCGCTCTATGGGCGCAAGTGAAGATATTATAG |
| Sequence | MLILTRKLGESIVIGDQIQITLLDIKGKHVRIGVNAPKGIAVHRGEVYEMIQDENKKAFESDVKNSEMLSALWAQVKIL |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 17442750 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q2LT33 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1378361 | 1378600 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 2237947 | 2238201 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 3 | 281384 | 281605 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 4 | 3625458 | 3625712 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 5 | 3344894 | 3345121 | + | NC_016620.1 | Halobacteriovorax marinus SJ |
| 6 | 402855 | 403049 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 7 | 4064200 | 4064400 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 8 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 9 | 504164 | 504391 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 10 | 2980548 | 2980748 | - | NZ_CP037951.1 | Parashewanella tropica |
| 11 | 7623788 | 7624021 | + | NZ_CP036276.1 | Symmachiella dynata |
| 12 | 1216984 | 1217190 | - | NZ_CP036276.1 | Symmachiella dynata |
| 13 | 2760807 | 2761004 | - | NZ_CP020931.1 | Marinobacter salarius |
| 14 | 3912643 | 3912897 | - | NZ_CP040840.1 | Leptospira weilii |
| 15 | 1580416 | 1580646 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 16 | 2560881 | 2561126 | - | NZ_CP012678.1 | Psychrobacter urativorans |
| 17 | 1053019 | 1053264 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 18 | 4062977 | 4063231 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
| 19 | 2278457 | 2278711 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 20 | 1709079 | 1709276 | - | NZ_CP017715.1 | Marinobacter salinus |
| 21 | 2478770 | 2478964 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 22 | 1385142 | 1385339 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 23 | 2589824 | 2590054 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 24 | 810094 | 810300 | + | NC_022664.1 | Spiribacter curvatus |
| 25 | 2335013 | 2335252 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 26 | 2012582 | 2012821 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 1208148 | 1208402 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 28 | 2119765 | 2119959 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 29 | 705009 | 705206 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 30 | 1967888 | 1968094 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 31 | 501548 | 501793 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 32 | 2482530 | 2482727 | + | NZ_CP023559.1 | Salinicola tamaricis |
| 33 | 1322888 | 1323100 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 34 | 505138 | 505332 | + | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 35 | 207133 | 207357 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 36 | 190154 | 190378 | + | NZ_CP019401.1 | Planococcus faecalis |
| 37 | 198739 | 198963 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 38 | 895717 | 895914 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 39 | 3862801 | 3863034 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 40 | 1107755 | 1107952 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 41 | 178262 | 178486 | + | NZ_CP016540.2 | Planococcus versutus |
| 42 | 3193307 | 3193501 | - | NZ_CP054301.1 | Marinomonas primoryensis |
| 43 | 2929340 | 2929546 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 44 | 122156 | 122371 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 45 | 2715339 | 2715533 | - | NZ_CP049044.1 | Pseudomonas psychrophila |
| 46 | 1776935 | 1777180 | + | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 47 | 4087129 | 4087323 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 48 | 563117 | 563347 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 49 | 2020625 | 2020870 | + | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 50 | 3998573 | 3998767 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 51 | 6146081 | 6146293 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 52 | 1690318 | 1690518 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 53 | 4004282 | 4004476 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 54 | 262089 | 262334 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 55 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 56 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 57 | 3067624 | 3067863 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 58 | 187245 | 187469 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 59 | 1573645 | 1573881 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 60 | 2693365 | 2693589 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 61 | 1572340 | 1572564 | - | NZ_CP013661.2 | Planococcus kocurii |
| 62 | 3187364 | 3187600 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 63 | 21548 | 21778 | + | NZ_CP009228.1 | Treponema putidum |
| 64 | 2353783 | 2354019 | - | NZ_CP013742.1 | Legionella pneumophila |
| 65 | 138158 | 138406 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 66 | 1265487 | 1265696 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 67 | 2290954 | 2291157 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 68 | 3538344 | 3538547 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 69 | 2227611 | 2227814 | + | NZ_CP023465.1 | Lysobacter capsici |
| 70 | 1468426 | 1468632 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 71 | 952253 | 952486 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 72 | 1959539 | 1959760 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 73 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 74 | 2390978 | 2391205 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
++ More..