Result : Q2LS66
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein SYNAS_10430 |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 1071416 |
| Right | 1071679 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAAAAACTACGTCTACATCCTGGAATGTTCCGATAAAACCCTGTACACAGGATGGACCGTTAACATAGAAAAACGGCTTCAGGAACATAACAGCGGCAAATACGGGGCAAAGTATACCAAATCACGGCGACCCGTTAAATTGGTCCATCTTGAAATGGTCGATAGTTTGTCGGGGGTCTTGAAGCGAGAGGCACAGATCAAAAAGATGTCTCGTGCGGAGAAGTTGCAGTTAATAAAACAAAACCCTGAAAGGATGTAA |
| Sequence | MSKNYVYILECSDKTLYTGWTVNIEKRLQEHNSGKYGAKYTKSRRPVKLVHLEMVDSLSGVLKREAQIKKMSRAEKLQLIKQNPERM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 17442750 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | Q2LS66 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 213
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1071416 | 1071679 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 335383 | 335631 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 3 | 682804 | 683052 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 4 | 2045902 | 2046150 | + | NC_014624.2 | Eubacterium callanderi |
| 5 | 3781065 | 3781313 | + | NZ_CP019962.1 | Eubacterium limosum |
| 6 | 938769 | 939017 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 7 | 2338392 | 2338640 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 8 | 3931356 | 3931613 | + | NZ_CP022684.1 | Ketobacter alkanivorans |
| 9 | 2339117 | 2339365 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 10 | 66372 | 66638 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 11 | 2445602 | 2445874 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 12 | 893640 | 893855 | - | NZ_HG917868.1 | Clostridium bornimense |
| 13 | 1753198 | 1753452 | - | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 14 | 171444 | 171692 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 15 | 2388113 | 2388361 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 16 | 3276382 | 3276630 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 17 | 181574 | 181828 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 18 | 3794159 | 3794401 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 19 | 2113797 | 2114054 | + | NZ_CP070062.1 | Coprococcus comes |
| 20 | 1449390 | 1449656 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 21 | 301683 | 301922 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 22 | 117564 | 117809 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 23 | 1530350 | 1530586 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 24 | 3060082 | 3060351 | - | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 25 | 1488754 | 1488996 | - | NC_008593.1 | Clostridium novyi NT |
| 26 | 1618899 | 1619135 | - | NZ_CP058334.1 | Natronomonas halophila |
| 27 | 2343317 | 2343571 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 28 | 1279059 | 1279307 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 29 | 307413 | 307640 | + | NZ_CP016786.1 | Clostridium isatidis |
| 30 | 2757885 | 2758136 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 31 | 116856 | 117119 | + | NZ_CP048649.1 | Aminipila butyrica |
| 32 | 745982 | 746221 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 33 | 2329533 | 2329781 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 34 | 3041399 | 3041662 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 35 | 1356236 | 1356496 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 36 | 2073306 | 2073551 | + | NZ_CP023671.1 | Clostridium septicum |
| 37 | 2316231 | 2316485 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 38 | 464519 | 464764 | - | NZ_CP027770.1 | Staphylococcus felis |
| 39 | 270082 | 270330 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 40 | 2328254 | 2328505 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 41 | 2256582 | 2256830 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 42 | 314291 | 314542 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 43 | 749037 | 749285 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 44 | 1638635 | 1638889 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 45 | 2796146 | 2796424 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 46 | 1472454 | 1472702 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 47 | 1799594 | 1799851 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 48 | 247124 | 247378 | + | NZ_CP043998.1 | Clostridium diolis |
| 49 | 169487 | 169735 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 50 | 1081250 | 1081510 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 51 | 3722965 | 3723240 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 52 | 3109549 | 3109794 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 53 | 298038 | 298259 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 54 | 1189498 | 1189785 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 55 | 3547504 | 3547746 | - | NZ_CP028842.1 | Clostridium botulinum |
| 56 | 286933 | 287154 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 57 | 391352 | 391585 | - | NC_007426.1 | Natronomonas pharaonis DSM 2160 |
| 58 | 417164 | 417409 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 59 | 447986 | 448225 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 60 | 822637 | 822900 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 61 | 81471 | 81704 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 62 | 28810 | 29040 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 63 | 2461609 | 2461857 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 64 | 1006434 | 1006679 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 65 | 1465817 | 1466053 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 66 | 1407904 | 1408149 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 67 | 1467978 | 1468229 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 68 | 1955032 | 1955280 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 69 | 61858 | 62112 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 70 | 1373287 | 1373535 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 71 | 1692407 | 1692661 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 72 | 1628973 | 1629221 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 73 | 2310867 | 2311121 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 74 | 1142789 | 1143043 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 75 | 1919402 | 1919683 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 76 | 2305187 | 2305435 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 77 | 1020518 | 1020781 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 78 | 34773 | 35036 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 79 | 476305 | 476553 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 80 | 2223015 | 2223239 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 81 | 1505065 | 1505301 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 82 | 2514729 | 2514989 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 83 | 1331475 | 1331726 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 84 | 6101290 | 6101550 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 85 | 1981728 | 1981976 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 86 | 1747630 | 1747878 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 87 | 2456869 | 2457120 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 88 | 197612 | 197863 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 89 | 113505 | 113756 | + | NZ_CP034145.1 | Haloplanus aerogenes |
| 90 | 1050196 | 1050432 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 91 | 1942391 | 1942618 | - | NZ_CP082286.1 | Halobaculum roseum |
| 92 | 2986077 | 2986313 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 93 | 3125249 | 3125479 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 94 | 3856539 | 3856814 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 95 | 2560885 | 2561145 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 96 | 1044254 | 1044505 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 97 | 636421 | 636669 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 98 | 2297531 | 2297785 | - | NZ_CP047361.1 | Macrococcus canis |
| 99 | 3469026 | 3469247 | - | NZ_CP030775.1 | Clostridium butyricum |
| 100 | 1525928 | 1526161 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 101 | 341181 | 341405 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 102 | 2996752 | 2996988 | + | NZ_CP030356.1 | Salinibacter ruber |
| 103 | 556891 | 557142 | + | NZ_CP031150.1 | Haloplanus rubicundus |
| 104 | 5618040 | 5618285 | + | NZ_CP020953.1 | Clostridium drakei |
| 105 | 4771399 | 4771644 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 106 | 1415264 | 1415488 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 107 | 2079573 | 2079818 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 108 | 2456203 | 2456451 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 109 | 2043696 | 2043926 | + | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 110 | 1319994 | 1320269 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 111 | 914993 | 915244 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 112 | 49023 | 49271 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 113 | 2618403 | 2618636 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 114 | 4282962 | 4283207 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 115 | 1985907 | 1986128 | - | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 116 | 2333008 | 2333280 | - | NZ_CP058335.1 | Natronomonas salina |
| 117 | 6178664 | 6178900 | - | NZ_CP039126.1 | Blautia producta |
| 118 | 3625798 | 3626025 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 119 | 460343 | 460591 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 120 | 395295 | 395522 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 121 | 1420593 | 1420841 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 122 | 2255119 | 2255367 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 123 | 1674226 | 1674474 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 124 | 1072420 | 1072677 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 125 | 2650632 | 2650892 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 126 | 316183 | 316449 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 127 | 334660 | 334917 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 128 | 6536561 | 6536827 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 129 | 472139 | 472387 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 130 | 1456158 | 1456397 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 131 | 1085215 | 1085457 | + | NC_013202.1 | Halomicrobium mukohataei DSM 12286 |
| 132 | 1130819 | 1131091 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 133 | 4103113 | 4103352 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 134 | 22618 | 22872 | - | NZ_CP030280.1 | Blautia argi |
| 135 | 1286021 | 1286287 | - | NZ_CP009761.1 | Parvimonas micra |
| 136 | 690846 | 691106 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 137 | 1273971 | 1274222 | - | NZ_LR134293.1 | Streptococcus canis |
| 138 | 2351984 | 2352247 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 139 | 2733480 | 2733728 | + | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 140 | 565826 | 566086 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 141 | 27308 | 27556 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 142 | 335777 | 336031 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 143 | 1894565 | 1894807 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 144 | 783475 | 783720 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 145 | 783508 | 783759 | + | NZ_CP009687.1 | Clostridium aceticum |
| 146 | 898270 | 898518 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 147 | 1387170 | 1387430 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 148 | 54332 | 54577 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 149 | 226404 | 226646 | + | NC_014297.1 | Halalkalicoccus jeotgali B3 |
| 150 | 1449089 | 1449340 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 151 | 749828 | 750076 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 152 | 2879375 | 2879632 | - | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 153 | 1057117 | 1057365 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 154 | 1495078 | 1495320 | + | NC_012924.1 | Streptococcus suis SC84 |
| 155 | 367682 | 367924 | + | NZ_CP014204.2 | Clostridium baratii |
| 156 | 612538 | 612810 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 157 | 42125 | 42373 | + | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 158 | 176130 | 176369 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 159 | 2766395 | 2766652 | + | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 160 | 2290575 | 2290832 | - | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 161 | 150579 | 150866 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 162 | 94613 | 94891 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 163 | 1107043 | 1107294 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 164 | 2797573 | 2797851 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 165 | 59771 | 59989 | + | NZ_CP034118.1 | Staphylospora marina |
| 166 | 52507 | 52749 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 167 | 796964 | 797215 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 168 | 589696 | 589956 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 169 | 694089 | 694355 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 170 | 1121835 | 1122104 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 171 | 778270 | 778551 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 172 | 2104497 | 2104742 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 173 | 196208 | 196462 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 174 | 3730107 | 3730415 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
| 175 | 1965278 | 1965574 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 176 | 527615 | 527878 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 177 | 5746525 | 5746755 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 178 | 501969 | 502199 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 179 | 4167273 | 4167506 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 180 | 1045895 | 1046161 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 181 | 757193 | 757444 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 182 | 520989 | 521234 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 183 | 535147 | 535407 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 184 | 1412163 | 1412402 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 185 | 116429 | 116704 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 186 | 1158457 | 1158723 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 187 | 1594186 | 1594449 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 188 | 8056726 | 8057007 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 189 | 1717823 | 1718092 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 190 | 2272376 | 2272606 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 191 | 3494062 | 3494346 | - | NZ_CP036276.1 | Symmachiella dynata |
| 192 | 4127216 | 4127464 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 193 | 2046688 | 2046924 | - | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 194 | 1513271 | 1513570 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 195 | 2629085 | 2629363 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 196 | 902505 | 902786 | + | NZ_LT605586.1 | Brucella inopinata |
| 197 | 4776199 | 4776468 | - | NZ_CP021434.1 | Tumebacillus avium |
| 198 | 765282 | 765533 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 199 | 3475970 | 3476206 | - | NZ_CP036422.1 | Halioglobus maricola |
| 200 | 1556348 | 1556599 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 201 | 2665233 | 2665463 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 202 | 2095279 | 2095497 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 203 | 1026494 | 1026775 | + | NC_009504.1 | Brucella ovis ATCC 25840 |
| 204 | 1023847 | 1024128 | + | NC_004311.2 | Brucella suis 1330 |
| 205 | 274867 | 275148 | - | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
| 206 | 270113 | 270394 | - | NC_022906.1 | Brucella ceti TE10759-12 |
| 207 | 2022781 | 2023062 | + | NZ_CP064063.1 | Brucella anthropi |
| 208 | 1025049 | 1025330 | + | NC_013118.1 | Brucella microti CCM 4915 |
| 209 | 1963147 | 1963383 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 210 | 973997 | 974278 | + | NC_007624.1 | Brucella abortus 2308 |
| 211 | 1978197 | 1978487 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 212 | 26513 | 26794 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 213 | 1023262 | 1023543 | + | NC_010104.1 | Brucella canis ATCC 23365 |
++ More..