Result : Q2LQM2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 199378 |
| Right | 199563 |
| Strand | - |
| Nucleotide Sequence | ATGCCAAATCCAGTAAAAAGACATTCCAGAACGAGAAGAAATATGAGAAGGGCGCACGATTTTCTCACTCCTGTCCAGGCTTCAGCCTGTCCCCAGTGCGGTAAATTCAAGCTGCCTCACCGGGTCTGCCCCTACTGCGGGACCTACAAAGGCCGGACCGTGATCAAAGTGGAAAATCTTGCCTGA |
| Sequence | MPNPVKRHSRTRRNMRRAHDFLTPVQASACPQCGKFKLPHRVCPYCGTYKGRTVIKVENLA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17442750 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2LQM2 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 145
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 199378 | 199563 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 2873184 | 2873366 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 3 | 3597790 | 3597972 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 4 | 1798827 | 1799009 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 5 | 1775742 | 1775924 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 6 | 2175466 | 2175648 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 7 | 1751670 | 1751852 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 8 | 3954645 | 3954833 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 9 | 1275152 | 1275334 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 10 | 819364 | 819549 | + | NZ_CP042806.1 | Terriglobus albidus |
| 11 | 371320 | 371505 | - | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 12 | 1873945 | 1874130 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 13 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 14 | 2269010 | 2269198 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 15 | 5583344 | 5583529 | - | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 16 | 1219759 | 1219935 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 17 | 1379887 | 1380069 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 18 | 861213 | 861389 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 19 | 2065775 | 2065960 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 20 | 2774579 | 2774764 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 21 | 1661322 | 1661507 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 22 | 1681429 | 1681605 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 23 | 1187851 | 1188033 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 24 | 2641561 | 2641740 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 25 | 1455052 | 1455237 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 26 | 984332 | 984517 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 27 | 1419168 | 1419353 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 28 | 4836705 | 4836893 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 29 | 851166 | 851348 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 30 | 2534925 | 2535104 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 31 | 652334 | 652516 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 32 | 739028 | 739213 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 33 | 1504173 | 1504355 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 34 | 644575 | 644769 | + | NC_016024.1 | Chloracidobacterium thermophilum B |
| 35 | 2301030 | 2301218 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 36 | 1686010 | 1686195 | + | NZ_LT828648.1 | Nitrospira japonica |
| 37 | 1670019 | 1670201 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 38 | 623339 | 623524 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 39 | 2790836 | 2791042 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 40 | 1518673 | 1518855 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 41 | 1150431 | 1150637 | + | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 42 | 402507 | 402686 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 43 | 2631019 | 2631225 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 44 | 1748652 | 1748819 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 45 | 1136158 | 1136340 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 46 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 47 | 2557118 | 2557300 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 48 | 5263859 | 5264044 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 49 | 137691 | 137873 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 50 | 2001719 | 2001904 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 51 | 2190921 | 2191100 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 52 | 1204701 | 1204889 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 53 | 2946506 | 2946682 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 54 | 1927486 | 1927653 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 55 | 2164210 | 2164389 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 56 | 2232636 | 2232818 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 57 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 58 | 1325807 | 1325986 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 59 | 3036211 | 3036399 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 60 | 1127728 | 1127907 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 61 | 2269818 | 2270000 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 62 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 63 | 1483349 | 1483537 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 64 | 3020453 | 3020635 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 65 | 2285039 | 2285215 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 66 | 1031502 | 1031684 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 67 | 2434069 | 2434242 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 68 | 2085910 | 2086083 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 69 | 878822 | 878995 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 70 | 743797 | 743970 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 71 | 725284 | 725457 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 72 | 1788692 | 1788865 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 73 | 2501011 | 2501193 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 74 | 1435564 | 1435746 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 75 | 620203 | 620385 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 76 | 2386203 | 2386385 | - | NZ_CP038452.1 | Thermus caldilimi |
| 77 | 1163949 | 1164155 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 78 | 1054381 | 1054554 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 79 | 1985463 | 1985645 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 80 | 5444947 | 5445120 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 81 | 3286658 | 3286831 | + | NZ_CP034437.1 | Paenibacillus albus |
| 82 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 83 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 84 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 85 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 86 | 10899374 | 10899562 | + | NZ_CP012333.1 | Labilithrix luteola |
| 87 | 396721 | 396903 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 88 | 3489690 | 3489863 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 89 | 1845472 | 1845651 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 90 | 2873238 | 2873411 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 91 | 1709708 | 1709881 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 92 | 1579642 | 1579809 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 93 | 912440 | 912613 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 94 | 1323746 | 1323928 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 95 | 292378 | 292560 | + | NZ_CP021081.1 | Deinococcus ficus |
| 96 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 97 | 2750372 | 2750545 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 98 | 1362718 | 1362906 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 99 | 1333899 | 1334081 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 100 | 1312099 | 1312281 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 101 | 4003695 | 4003868 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 102 | 2776749 | 2776922 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 103 | 1040970 | 1041143 | + | NZ_CP033433.1 | Cohnella candidum |
| 104 | 2539668 | 2539841 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 105 | 2608753 | 2608926 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 106 | 3024857 | 3025030 | + | NZ_CP009288.1 | Paenibacillus durus |
| 107 | 3026616 | 3026789 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 108 | 5261909 | 5262082 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 109 | 3355085 | 3355258 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 110 | 5260224 | 5260397 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 111 | 3732024 | 3732197 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 112 | 3847434 | 3847607 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 113 | 2799146 | 2799319 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 114 | 1427744 | 1427917 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 115 | 1393685 | 1393840 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 116 | 1012418 | 1012591 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 117 | 3571920 | 3572093 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 118 | 3444015 | 3444164 | - | NZ_CP016211.1 | Minicystis rosea |
| 119 | 1843396 | 1843578 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 120 | 1449538 | 1449714 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 121 | 1421752 | 1421934 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 122 | 1498647 | 1498829 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 123 | 2471199 | 2471372 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 124 | 1498932 | 1499114 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 125 | 4637492 | 4637665 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 126 | 3248592 | 3248741 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 127 | 411814 | 412020 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 128 | 875114 | 875293 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 129 | 5499325 | 5499480 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 130 | 3034510 | 3034689 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 131 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 132 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 133 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 134 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 135 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 136 | 3661909 | 3662094 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 137 | 4476239 | 4476394 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 138 | 9086185 | 9086337 | + | NZ_AP022870.1 | Phytohabitans flavus |
| 139 | 5877046 | 5877234 | - | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 140 | 655565 | 655738 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 141 | 460497 | 460670 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 142 | 3034752 | 3034928 | + | NZ_CP021323.1 | Kushneria konosiri |
| 143 | 201800 | 201976 | - | NZ_CP021358.1 | Kushneria marisflavi |
| 144 | 1432210 | 1432392 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 145 | 484587 | 484772 | - | NZ_LT996885.1 | Dialister massiliensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011979.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.89 | 129 | 54 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 2 | PF02504.17 | 0.69 | 100 | 64.0 | same-strand | Fatty acid synthesis protein |
| 3 | PF08541.12 | 0.65 | 94 | 1191.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 4 | PF08545.12 | 0.65 | 94 | 1191.5 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
++ More..