Result : A7HN71
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000771.1 |
| Organism | Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) |
| Left | 1638988 |
| Right | 1639239 |
| Strand | - |
| Nucleotide Sequence | ATGCTGGTTCTTTCGAGAAAAATTGGAGAAAGTATAATTATAGGTGATAATATCGAAGTAAAAGTTTTAAAAATAGAAAGCGGAACTGTAAAAATAGGAATAATAGCACCAACAAATGTAAAAATATACCGGCAAGAGATTTATCAAACAGTTGCTGAGCAAAATAAAAAAACTATTAGTGAAATAGTAAATAGTCCTGATGATTTGAAACATCTAAAGGAGGTACTTAAAAATGTCAATAAAAATAGATGA |
| Sequence | MLVLSRKIGESIIIGDNIEVKVLKIESGTVKIGIIAPTNVKIYRQEIYQTVAEQNKKTISEIVNSPDDLKHLKEVLKNVNKNR |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | A7HN71 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1638988 | 1639239 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 2 | 67057 | 67302 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 3 | 68638 | 68883 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 4 | 786433 | 786684 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 5 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 6 | 1571353 | 1571586 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 7 | 1051528 | 1051752 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 8 | 4857743 | 4857973 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 9 | 4174689 | 4174940 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 10 | 3034388 | 3034618 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 11 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 12 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 13 | 200091 | 200312 | + | NZ_CP059540.1 | Planococcus maritimus |
| 14 | 200237 | 200458 | + | NZ_CP016538.2 | Planococcus maritimus |
| 15 | 3391145 | 3391366 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 16 | 203711 | 203932 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 17 | 371180 | 371401 | + | NZ_LN879430.1 | Herbinix luporum |
| 18 | 2724268 | 2724495 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 19 | 777447 | 777674 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 20 | 3881618 | 3881845 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 21 | 1460861 | 1461091 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 22 | 185468 | 185704 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 23 | 565122 | 565340 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 24 | 915274 | 915525 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 25 | 679295 | 679546 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 26 | 185748 | 185984 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 27 | 185393 | 185629 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 28 | 197966 | 198202 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 29 | 681387 | 681638 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 30 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 31 | 1017009 | 1017251 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 32 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 0.87 | 27 | 3.0 | same-strand | FliW protein |
| 2 | PF00669.22 | 0.65 | 20 | 509 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.65 | 20 | 792.5 | same-strand | Bacterial flagellin C-terminal helical region |
++ More..