Result : Q2LQB2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000252.1 |
| Organism | Syntrophus aciditrophicus (strain SB) |
| Left | 318103 |
| Right | 318300 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGCTAAAGAATGGAGAGAGAAAAGCCTTGATGAGATAAGGCAAAAAAATAAAGAGTTGGAAGAGGAGCTTTTTAACCTGAGAATGCGCAGTGCTGCGGGGCAGCTGGAATCATCAGCGGCGCTTGGAAAAATAAAAAGGGATATAGCACGTGCAAAAACAGTGTTACGGGAAAAGGGGGTTAAAGAGCATTGA |
| Sequence | MKAKEWREKSLDEIRQKNKELEEELFNLRMRSAAGQLESSAALGKIKRDIARAKTVLREKGVKEH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 17442750 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2LQB2 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 412
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 318103 | 318300 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 2 | 2697272 | 2697460 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 3 | 390625 | 390816 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 4 | 434691 | 434891 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 5 | 132456 | 132647 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 6 | 4198178 | 4198369 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 7 | 345945 | 346151 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 8 | 479266 | 479472 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 9 | 365042 | 365233 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 10 | 453034 | 453225 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 11 | 3268666 | 3268866 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 12 | 1220636 | 1220851 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 13 | 2674030 | 2674221 | - | NZ_CP017715.1 | Marinobacter salinus |
| 14 | 2979100 | 2979300 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 15 | 132214 | 132414 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 16 | 2825866 | 2826066 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 17 | 140921 | 141121 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 2263947 | 2264147 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 19 | 620673 | 620864 | + | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 20 | 1377659 | 1377856 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 21 | 1466931 | 1467128 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 22 | 48200 | 48412 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 23 | 3789526 | 3789717 | - | NZ_CP020931.1 | Marinobacter salarius |
| 24 | 244239 | 244451 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 25 | 458129 | 458320 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 26 | 808703 | 808894 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 27 | 151302 | 151499 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 28 | 157892 | 158089 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 29 | 160875 | 161072 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 30 | 271422 | 271619 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 31 | 3074540 | 3074752 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 32 | 3096340 | 3096540 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 33 | 2818537 | 2818737 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 34 | 184145 | 184357 | + | NZ_CP034118.1 | Staphylospora marina |
| 35 | 476082 | 476279 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 36 | 2539138 | 2539338 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 37 | 4581909 | 4582109 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 38 | 1158097 | 1158291 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 39 | 1291034 | 1291225 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 40 | 2358774 | 2358977 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 41 | 1986691 | 1986903 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 42 | 242370 | 242582 | + | NZ_CP047361.1 | Macrococcus canis |
| 43 | 327031 | 327243 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 44 | 2344065 | 2344268 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 45 | 124152 | 124352 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 46 | 1652487 | 1652675 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 47 | 750673 | 750864 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 48 | 161055 | 161258 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 49 | 1438405 | 1438611 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 50 | 155853 | 156053 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 51 | 285367 | 285564 | - | NZ_CP026363.1 | Brevibacillus agri |
| 52 | 1318653 | 1318859 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 53 | 184965 | 185165 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 54 | 1197906 | 1198106 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 55 | 3440736 | 3440939 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 56 | 2487738 | 2487926 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 57 | 983793 | 983984 | - | NZ_CP048812.1 | Halomonas socia |
| 58 | 1175029 | 1175223 | - | NZ_CP023559.1 | Salinicola tamaricis |
| 59 | 143151 | 143351 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 60 | 1370395 | 1370595 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 61 | 2192063 | 2192257 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 62 | 73445 | 73636 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 63 | 3932028 | 3932219 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 64 | 2328947 | 2329147 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 65 | 282422 | 282616 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 66 | 516835 | 517029 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 67 | 3108211 | 3108399 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 68 | 132279 | 132452 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 69 | 142923 | 143126 | + | NZ_CP012024.1 | Bacillus smithii |
| 70 | 2076155 | 2076358 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 71 | 132555 | 132758 | + | NZ_LS483476.1 | Lederbergia lentus |
| 72 | 2326349 | 2326546 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 73 | 56635 | 56835 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 74 | 204585 | 204776 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 75 | 972016 | 972207 | - | NZ_CP014056.2 | Grimontia hollisae |
| 76 | 138039 | 138239 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 77 | 170519 | 170719 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 78 | 146504 | 146704 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 79 | 150875 | 151075 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 80 | 2135708 | 2135914 | - | NZ_CP029256.1 | Christensenella minuta |
| 81 | 2376984 | 2377181 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 82 | 224366 | 224563 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 83 | 173353 | 173556 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 84 | 1532582 | 1532779 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 85 | 664738 | 664935 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 86 | 781436 | 781633 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 87 | 1470367 | 1470558 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 88 | 2574412 | 2574612 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 89 | 2121222 | 2121413 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 90 | 134606 | 134806 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 91 | 1631193 | 1631396 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 92 | 2374725 | 2374928 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 93 | 271049 | 271258 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 94 | 141190 | 141393 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 95 | 4043688 | 4043891 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 96 | 151793 | 151993 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 97 | 1260685 | 1260879 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 98 | 3453531 | 3453731 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 99 | 3790457 | 3790657 | - | NZ_CP011937.1 | Bacillus velezensis |
| 100 | 275912 | 276112 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 101 | 139865 | 140065 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 102 | 140884 | 141084 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 103 | 139625 | 139825 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 104 | 139751 | 139951 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 105 | 109645 | 109845 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 106 | 1869577 | 1869777 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 107 | 139924 | 140124 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 108 | 135171 | 135374 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 109 | 1942057 | 1942257 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 110 | 145633 | 145836 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 111 | 254493 | 254696 | + | NZ_CP053989.1 | Niallia circulans |
| 112 | 519911 | 520102 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 113 | 2404644 | 2404829 | + | NC_017856.1 | Methylophaga frappieri |
| 114 | 4255203 | 4255394 | - | NZ_CP050150.1 | Hafnia alvei |
| 115 | 647916 | 648113 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 116 | 52654 | 52854 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 117 | 148351 | 148551 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 118 | 2117966 | 2118166 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 119 | 1488434 | 1488634 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 120 | 113204 | 113404 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 121 | 1405500 | 1405700 | - | NZ_CP043404.1 | Bacillus safensis |
| 122 | 334989 | 335189 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 123 | 342289 | 342486 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 124 | 337584 | 337781 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 125 | 340531 | 340728 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 126 | 2059350 | 2059538 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 127 | 3124836 | 3125024 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 128 | 4130937 | 4131137 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 129 | 1845327 | 1845527 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 130 | 141770 | 141970 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 131 | 1752290 | 1752490 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 132 | 4740022 | 4740222 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 133 | 2620016 | 2620207 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 134 | 124994 | 125185 | - | NC_013456.1 | Vibrio antiquarius |
| 135 | 2996135 | 2996326 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 136 | 1804501 | 1804698 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 137 | 2012442 | 2012627 | - | NC_006085.1 | Cutibacterium acnes KPA171202 |
| 138 | 1534906 | 1535139 | - | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 139 | 143230 | 143430 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 140 | 3639466 | 3639657 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 141 | 239759 | 239947 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 142 | 66514 | 66702 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 143 | 71014 | 71202 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 144 | 73621 | 73809 | + | NZ_CP065211.1 | Enterococcus lactis |
| 145 | 2430066 | 2430254 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 146 | 586054 | 586242 | - | NZ_CP023011.2 | Enterococcus hirae |
| 147 | 3161873 | 3162061 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 148 | 257222 | 257410 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 149 | 145929 | 146129 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 150 | 125979 | 126182 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 151 | 747882 | 748070 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 152 | 2251698 | 2251931 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 153 | 1103098 | 1103307 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 154 | 288938 | 289129 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 155 | 975014 | 975214 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 156 | 941205 | 941411 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 157 | 325904 | 326110 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 158 | 383145 | 383336 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 159 | 8373599 | 8373799 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 160 | 1967510 | 1967701 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 161 | 689833 | 690033 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 162 | 715989 | 716189 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 163 | 2084221 | 2084415 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 164 | 2412175 | 2412378 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 165 | 132617 | 132817 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 166 | 1388394 | 1388588 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 167 | 1563886 | 1564080 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 168 | 1654562 | 1654750 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 169 | 2694784 | 2694987 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 170 | 636694 | 636900 | + | NZ_CP009761.1 | Parvimonas micra |
| 171 | 6389280 | 6389477 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 172 | 924572 | 924778 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 173 | 111312 | 111521 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 174 | 772233 | 772466 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 175 | 3824373 | 3824564 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 176 | 146226 | 146426 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 177 | 6313346 | 6313546 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 178 | 1808021 | 1808221 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 179 | 175199 | 175399 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 180 | 6055463 | 6055663 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 181 | 330891 | 331082 | + | NZ_AP018933.1 | Zymobacter palmae |
| 182 | 2000723 | 2000887 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 183 | 726455 | 726646 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 184 | 619948 | 620139 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 185 | 750663 | 750860 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 186 | 742501 | 742698 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 187 | 1682634 | 1682837 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 188 | 3304652 | 3304846 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 189 | 2171368 | 2171568 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 190 | 2139161 | 2139391 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 191 | 487164 | 487358 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 192 | 134198 | 134398 | + | NZ_CP016540.2 | Planococcus versutus |
| 193 | 143858 | 144058 | + | NZ_CP016538.2 | Planococcus maritimus |
| 194 | 143699 | 143899 | + | NZ_CP059540.1 | Planococcus maritimus |
| 195 | 166360 | 166560 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 196 | 1616306 | 1616506 | - | NZ_CP013661.2 | Planococcus kocurii |
| 197 | 146371 | 146571 | + | NZ_CP019401.1 | Planococcus faecalis |
| 198 | 3332017 | 3332217 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 199 | 150886 | 151086 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 200 | 2304374 | 2304571 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 201 | 303456 | 303647 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 202 | 3270623 | 3270835 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 203 | 2016009 | 2016200 | + | NZ_CP061205.1 | Kordiimonas pumila |
| 204 | 2090835 | 2091065 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 205 | 434593 | 434787 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 206 | 4496811 | 4497011 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 207 | 247718 | 247918 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 208 | 203905 | 204105 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 209 | 225578 | 225778 | - | NZ_CP034437.1 | Paenibacillus albus |
| 210 | 4222306 | 4222506 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 211 | 3678880 | 3679071 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 212 | 4071591 | 4071788 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 213 | 1098305 | 1098499 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 214 | 2610152 | 2610349 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 215 | 513237 | 513428 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
| 216 | 2443035 | 2443229 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 217 | 2442974 | 2443168 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 218 | 2791057 | 2791257 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 219 | 1422325 | 1422519 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 220 | 3620039 | 3620239 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 221 | 3432951 | 3433142 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 222 | 2863649 | 2863858 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 223 | 1667657 | 1667854 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 224 | 2745838 | 2746059 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 225 | 171801 | 171992 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 226 | 50803 | 51000 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 227 | 1544079 | 1544282 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 228 | 2118305 | 2118496 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 229 | 3951757 | 3951948 | - | NZ_LR134340.1 | Escherichia marmotae |
| 230 | 1441966 | 1442157 | - | NZ_CP053416.1 | Salmonella bongori |
| 231 | 3424575 | 3424766 | - | NZ_AP014857.1 | Escherichia albertii |
| 232 | 4346936 | 4347127 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 233 | 3830478 | 3830669 | + | NZ_CP038469.1 | Citrobacter tructae |
| 234 | 3591835 | 3592026 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 235 | 2832092 | 2832283 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 236 | 2250590 | 2250781 | - | NZ_CP033744.1 | Citrobacter freundii |
| 237 | 1657375 | 1657566 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 238 | 4761695 | 4761886 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 239 | 24999 | 25190 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 240 | 547526 | 547735 | + | NZ_CP014324.1 | Oenococcus oeni |
| 241 | 2369859 | 2370050 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 242 | 3448568 | 3448759 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 243 | 4183708 | 4183899 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 244 | 347311 | 347502 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 245 | 1574762 | 1574953 | - | NZ_CP047165.1 | Pelistega ratti |
| 246 | 793025 | 793219 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 247 | 761757 | 761945 | - | NZ_CP021323.1 | Kushneria konosiri |
| 248 | 2537556 | 2537744 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 249 | 2234157 | 2234390 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 250 | 1059150 | 1059350 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 251 | 4102488 | 4102679 | - | NZ_LS483422.1 | Providencia heimbachae |
| 252 | 151270 | 151470 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 253 | 3725089 | 3725289 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 254 | 1959835 | 1960032 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 255 | 4096903 | 4097094 | - | NZ_CP048796.1 | Providencia vermicola |
| 256 | 974058 | 974249 | + | NZ_CP029736.1 | Providencia rettgeri |
| 257 | 3564663 | 3564854 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 258 | 4872761 | 4872952 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 259 | 1682002 | 1682193 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 260 | 2278126 | 2278317 | - | NZ_CP035688.1 | Vibrio metoecus |
| 261 | 2620372 | 2620563 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 262 | 3096292 | 3096483 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 263 | 2913277 | 2913462 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 264 | 1708198 | 1708389 | + | NZ_CP026364.1 | Proteus hauseri |
| 265 | 1185771 | 1185962 | - | NZ_CP019706.1 | Pantoea alhagi |
| 266 | 4878006 | 4878197 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 267 | 3799569 | 3799760 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 268 | 226826 | 227017 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 269 | 3886917 | 3887108 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 270 | 3964272 | 3964463 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 271 | 80807 | 80998 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 272 | 376326 | 376517 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 273 | 4054161 | 4054352 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 274 | 408233 | 408424 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 275 | 2693153 | 2693344 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 276 | 4443214 | 4443405 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 277 | 711873 | 712064 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 278 | 425420 | 425611 | + | NZ_CP041247.1 | Raoultella electrica |
| 279 | 453854 | 454045 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 280 | 1252813 | 1253004 | - | NZ_CP026047.1 | Raoultella planticola |
| 281 | 463759 | 463950 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 282 | 4870195 | 4870386 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 283 | 2099865 | 2100062 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 284 | 255866 | 256057 | + | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 285 | 551250 | 551444 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 286 | 1065760 | 1065954 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 287 | 603924 | 604157 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 288 | 341536 | 341766 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 289 | 2716930 | 2717121 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 290 | 2853393 | 2853584 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 291 | 3184255 | 3184446 | + | NZ_AP019657.1 | Vibrio ponticus |
| 292 | 408956 | 409147 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 293 | 280258 | 280449 | + | NZ_CP030788.1 | Vibrio campbellii |
| 294 | 255227 | 255418 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 295 | 2822526 | 2822717 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 296 | 1543835 | 1544026 | - | NZ_CP019959.1 | Vibrio owensii |
| 297 | 487958 | 488149 | + | NZ_CP009467.1 | Vibrio harveyi |
| 298 | 1956313 | 1956504 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 299 | 4229059 | 4229250 | + | NZ_CP028271.1 | Mixta intestinalis |
| 300 | 167930 | 168130 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 301 | 4842169 | 4842369 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 302 | 1193918 | 1194109 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 303 | 1520167 | 1520361 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 304 | 574131 | 574325 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 305 | 489245 | 489475 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 306 | 138839 | 139030 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 307 | 3586908 | 3587099 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 308 | 405477 | 405668 | + | NZ_CP061511.1 | Mixta calida |
| 309 | 480094 | 480285 | + | NZ_CP026377.1 | Mixta gaviniae |
| 310 | 1474246 | 1474443 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 311 | 4143651 | 4143842 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 312 | 2939668 | 2939859 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 313 | 1255832 | 1256020 | + | NZ_CP064781.1 | Azospira restricta |
| 314 | 2423502 | 2423714 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 315 | 424113 | 424304 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 316 | 2446180 | 2446371 | - | NZ_CP049115.1 | Pantoea stewartii |
| 317 | 459615 | 459806 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 318 | 4586657 | 4586848 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 319 | 1887739 | 1887972 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 320 | 132200 | 132397 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 321 | 3330787 | 3330978 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 322 | 373238 | 373429 | + | NZ_LS483470.1 | Leminorella richardii |
| 323 | 308899 | 309090 | + | NZ_LR134531.1 | Pragia fontium |
| 324 | 367610 | 367807 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 325 | 2074785 | 2075012 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 326 | 2545787 | 2545978 | - | NZ_CP033078.1 | Vibrio zhugei |
| 327 | 121350 | 121541 | - | NZ_CP040990.1 | Vibrio furnissii |
| 328 | 3112398 | 3112589 | - | NZ_AP014635.1 | Vibrio tritonius |
| 329 | 2306397 | 2306627 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 330 | 3486478 | 3486669 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 331 | 275720 | 275911 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 332 | 3165816 | 3166007 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 333 | 4192449 | 4192640 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 334 | 3161347 | 3161538 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 335 | 1726007 | 1726216 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 336 | 1767067 | 1767276 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 337 | 708665 | 708874 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 338 | 1282666 | 1282875 | + | NZ_CP027770.1 | Staphylococcus felis |
| 339 | 1977241 | 1977450 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 340 | 3511207 | 3511398 | - | NZ_CP036422.1 | Halioglobus maricola |
| 341 | 648718 | 648927 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 342 | 1841202 | 1841405 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 343 | 439870 | 440061 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 344 | 483975 | 484166 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 345 | 372941 | 373132 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 346 | 2851611 | 2851802 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 347 | 1959035 | 1959265 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 348 | 2397511 | 2397702 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 349 | 6340753 | 6340944 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 350 | 2038495 | 2038725 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 351 | 2055195 | 2055425 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 352 | 2083385 | 2083618 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 353 | 1918174 | 1918365 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 354 | 550214 | 550411 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 355 | 2014327 | 2014518 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 356 | 287288 | 287479 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 357 | 3478365 | 3478556 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 358 | 1416862 | 1417053 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 359 | 155212 | 155376 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 360 | 922941 | 923144 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 361 | 319176 | 319367 | + | NZ_CP065534.1 | Lonsdalea populi |
| 362 | 747008 | 747199 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 363 | 857433 | 857621 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 364 | 844988 | 845176 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 365 | 215277 | 215468 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 366 | 209708 | 209899 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 367 | 742201 | 742392 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 368 | 4573811 | 4574002 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 369 | 1512220 | 1512411 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 370 | 66632 | 66838 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 371 | 75717 | 75923 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 372 | 874310 | 874516 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 373 | 4222632 | 4222823 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 374 | 628851 | 629081 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 375 | 659058 | 659258 | + | NZ_CP040709.1 | Inhella inkyongensis |
| 376 | 3298982 | 3299176 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 377 | 69002 | 69163 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 378 | 80710 | 80871 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 379 | 2013232 | 2013423 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 380 | 95716 | 95877 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 381 | 522389 | 522586 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 382 | 1832749 | 1832955 | - | NZ_LT906439.1 | Streptococcus merionis |
| 383 | 77537 | 77728 | - | NZ_LT907988.1 | Orrella dioscoreae |
| 384 | 209169 | 209360 | + | NZ_CP065135.1 | Halomonas venusta |
| 385 | 702038 | 702229 | - | NZ_CP059082.1 | Halomonas titanicae |
| 386 | 1753011 | 1753220 | + | NZ_CP013237.1 | Streptococcus mutans |
| 387 | 672597 | 672803 | + | NZ_CP043405.1 | Streptococcus ratti |
| 388 | 1912576 | 1912785 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 389 | 111083 | 111289 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 390 | 1484198 | 1484404 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 391 | 2452409 | 2452603 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 392 | 76846 | 77052 | + | NC_012924.1 | Streptococcus suis SC84 |
| 393 | 493436 | 493642 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 394 | 77991 | 78197 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 395 | 847315 | 847521 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 396 | 109804 | 110010 | + | NZ_LS483343.1 | Streptococcus ferus |
| 397 | 272488 | 272721 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 398 | 753892 | 754089 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 399 | 2170657 | 2170821 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 400 | 85786 | 85950 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 401 | 1760030 | 1760236 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 402 | 1857491 | 1857652 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 403 | 73783 | 73944 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 404 | 504246 | 504407 | - | NZ_LR134293.1 | Streptococcus canis |
| 405 | 74504 | 74665 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 406 | 59582 | 59743 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 407 | 1169382 | 1169543 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 408 | 1839314 | 1839475 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 409 | 2034102 | 2034308 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 410 | 366385 | 366576 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 411 | 506528 | 506722 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 412 | 1052412 | 1052615 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 413 | 1250646 | 1250849 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 414 | 293777 | 293971 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 415 | 1780916 | 1781122 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP010311.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.99 | 409 | 1786.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.99 | 409 | 1786.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00237.21 | 1.0 | 411 | 1119.0 | same-strand | Ribosomal protein L22p/L17e |
| 4 | PF00189.22 | 1.0 | 412 | 427 | same-strand | Ribosomal protein S3, C-terminal domain |
| 5 | PF07650.19 | 1.0 | 412 | 427 | same-strand | KH domain |
| 6 | PF00252.20 | 1.0 | 410 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 7 | PF00366.22 | 1.0 | 412 | 17 | same-strand | Ribosomal protein S17 |
| 8 | PF00238.21 | 0.96 | 394 | 333 | same-strand | Ribosomal protein L14p/L23e |
| 9 | PF17136.6 | 0.94 | 387 | 744.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 10 | PF00467.31 | 0.84 | 346 | 744 | same-strand | KOW motif |
| 11 | PF00673.23 | 0.95 | 393 | 1086 | same-strand | ribosomal L5P family C-terminus |
| 12 | PF00281.21 | 0.95 | 393 | 1086.5 | same-strand | Ribosomal protein L5 |
| 13 | PF00253.23 | 0.83 | 340 | 1649.0 | same-strand | Ribosomal protein S14p/S29e |
| 14 | PF00203.23 | 0.98 | 405 | 1481.0 | same-strand | Ribosomal protein S19 |
++ More..