Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center protein Ycf12 |
NCBI Accession ID | CP000239.1 |
Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
Left | 557019 |
Right | 557126 |
Strand | + |
Nucleotide Sequence | ATGTTCGGACAGTACGAAGTGTTTGTGCAGTTGCTGCTGTTGGCCTTGATCGTCCTGGCAGGGCCAGCGGTCATTCTGCTGCTTTACCTGCGCGGCGCCGATATGTAG |
Sequence | MFGQYEVFVQLLLLALIVLAGPAVILLLYLRGADM |
Source of smORF | Swiss-Prot |
Function | A core subunit of photosystem II (PSII). {ECO:0000255|HAMAP-Rule:MF_01329}. |
Pubmed ID | 18059494 |
Domain | CDD:421560 |
Functional Category | Others |
Uniprot ID | Q2JWU5 |
ORF Length (Amino Acid) | 35 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1815154 | 1815240 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
2 | 2709991 | 2710080 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
3 | 6078006 | 6078095 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
4 | 3270130 | 3270216 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03692.17 | 0.75 | 3 | 179 | opposite-strand | Putative zinc- or iron-chelating domain |