Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | CP000239.1 |
Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
Left | 935393 |
Right | 935695 |
Strand | + |
Nucleotide Sequence | ATGCCACGCATCAAATCTGCCATCAAGCGCGTCAAGATTGCGGAGCGAAATCGCCTGCGCAACAAAGCTACCAAAGCCATGGTGCGCGCGCTGATGAAAAAAGTCACTTCTCTCTCCTCTGCTTACGCCGCCAACCCCCAACCGGAAACCCTGCAGGAGATTCAAGCGGCGATGAGCGCTGCCTTTAGCCGCATCGACAAAGCGGCCAAAACAGGGGTTCTCCACAAAAACACAGCCGCCCGTCGGAAGGCGCGTTTGTCTCGGATCGTGCAACGATCCCTGGCCGCCACAAGTGCCTCCTAA |
Sequence | MPRIKSAIKRVKIAERNRLRNKATKAMVRALMKKVTSLSSAYAANPQPETLQEIQAAMSAAFSRIDKAAKTGVLHKNTAARRKARLSRIVQRSLAATSAS |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | 18059494 |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q2JVV4 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 495480 | 495782 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
2 | 6876081 | 6876380 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
3 | 7594492 | 7594743 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
4 | 4268034 | 4268327 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
5 | 3012706 | 3013005 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
6 | 1340961 | 1341257 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
7 | 1227936 | 1228232 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
8 | 5010274 | 5010567 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
9 | 40382 | 40681 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
10 | 3578718 | 3578966 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
11 | 646169 | 646459 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
12 | 2122886 | 2123179 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
13 | 6169437 | 6169736 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
14 | 202575 | 202868 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
15 | 5937224 | 5937520 | + | NZ_CP031941.1 | Nostoc sphaeroides |
16 | 1088813 | 1089097 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
17 | 1637904 | 1638200 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
18 | 2954025 | 2954339 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
19 | 3703137 | 3703436 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
20 | 154170 | 154478 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
21 | 1304500 | 1304796 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
22 | 1884025 | 1884324 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
23 | 5788253 | 5788546 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
24 | 820323 | 820616 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
25 | 2960983 | 2961279 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
26 | 2758156 | 2758449 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
27 | 3309411 | 3309719 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
28 | 3639977 | 3640261 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
29 | 2208861 | 2209148 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00815.22 | 0.69 | 20 | 336.0 | opposite-strand | Histidinol dehydrogenase |
2 | PF01026.23 | 0.93 | 27 | 88 | same-strand | TatD related DNase |
3 | PF00562.30 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase Rpb2, domain 6 |
4 | PF04561.16 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase Rpb2, domain 2 |
5 | PF04565.18 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase Rpb2, domain 3 |
6 | PF04560.22 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase Rpb2, domain 7 |
7 | PF04563.17 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase beta subunit |
8 | PF10385.11 | 0.83 | 24 | 1327.5 | same-strand | RNA polymerase beta subunit external 1 domain |
9 | PF04997.14 | 0.66 | 19 | 4875 | same-strand | RNA polymerase Rpb1, domain 1 |