Result : Q2JUT8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000239.1 |
| Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
| Left | 1355156 |
| Right | 1355449 |
| Strand | + |
| Nucleotide Sequence | ATGCTGACACGAGAAGAGGTGCAACATGTTGCCCACCTGGCGCGGCTGGAGCTTACGGAAGAAGAGGAAATCCAGTTTACCGAGCAACTGGCCGATATCTTGGCCTACGTGGAGCAACTGAAAGAACTGGATACGGAAGGGGTAGAGCCCACCTTTCATGTGCTGGATGCGGAGCTGCCCACTCGCCCCGACCAAGTGGAGCCCTACCCCAATATCGAAGGGATCCTGGCCAACGCCCCTGACCGGGCAGACATGTTCTTCAAGGTGCCCCGCATTTTGGAAGGGGAAGACTGA |
| Sequence | MLTREEVQHVAHLARLELTEEEEIQFTEQLADILAYVEQLKELDTEGVEPTFHVLDAELPTRPDQVEPYPNIEGILANAPDRADMFFKVPRILEGED |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 18059494 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q2JUT8 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 123
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3176511 | 3176804 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 2 | 3718972 | 3719229 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 3 | 2062250 | 2062540 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 3512076 | 3512357 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 5 | 3473123 | 3473407 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 6 | 3548170 | 3548418 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 7 | 3669843 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 8 | 3366639 | 3366929 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 9 | 7675287 | 7675577 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 4999804 | 5000061 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 11 | 3390944 | 3391234 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 12 | 1883388 | 1883687 | - | NZ_CP047361.1 | Macrococcus canis |
| 13 | 2521879 | 2522169 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 14 | 760639 | 760935 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 15 | 539342 | 539623 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 16 | 718121 | 718360 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 17 | 6157013 | 6157303 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 18 | 631788 | 632054 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 19 | 1359780 | 1360079 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 20 | 3072071 | 3072361 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 21 | 4433803 | 4434093 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 22 | 4732470 | 4732760 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 23 | 4004481 | 4004771 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 24 | 2134964 | 2135221 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 25 | 4280100 | 4280390 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 26 | 551541 | 551798 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 27 | 2404627 | 2404866 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 28 | 4026578 | 4026868 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 29 | 473113 | 473370 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 30 | 4432522 | 4432815 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 31 | 4167586 | 4167843 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 32 | 3488544 | 3488831 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 33 | 5199679 | 5199969 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 34 | 182894 | 183133 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 35 | 549895 | 550143 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 36 | 5188740 | 5188988 | - | NZ_AP019400.1 | Cohnella abietis |
| 37 | 93142 | 93429 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 38 | 4068443 | 4068700 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 39 | 92555 | 92842 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 40 | 1617451 | 1617687 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 41 | 716158 | 716415 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 42 | 926112 | 926360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 43 | 681918 | 682166 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 44 | 828283 | 828573 | - | NZ_CP043404.1 | Bacillus safensis |
| 45 | 976747 | 976995 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 46 | 2250281 | 2250571 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 47 | 986358 | 986648 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 48 | 455947 | 456213 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 49 | 2167488 | 2167778 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 50 | 1942125 | 1942424 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 51 | 4429739 | 4430035 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 52 | 3153158 | 3153394 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 53 | 204376 | 204624 | + | NZ_CP033433.1 | Cohnella candidum |
| 54 | 4504595 | 4504852 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 55 | 1992960 | 1993250 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 56 | 610194 | 610451 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 57 | 1034085 | 1034333 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 58 | 4199797 | 4200084 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 59 | 571234 | 571524 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 60 | 5726803 | 5727060 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 61 | 4964716 | 4964982 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 62 | 826718 | 827014 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 63 | 127542 | 127829 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 64 | 2245720 | 2245983 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 65 | 4541139 | 4541387 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 66 | 695761 | 696051 | + | NZ_CP053989.1 | Niallia circulans |
| 67 | 451311 | 451562 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 68 | 603102 | 603344 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 69 | 389884 | 390126 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 70 | 2123143 | 2123427 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 71 | 4011951 | 4012241 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 72 | 5929975 | 5930232 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 73 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 74 | 734211 | 734450 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 75 | 2301599 | 2301838 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 76 | 3462722 | 3462970 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 77 | 850134 | 850418 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 78 | 699842 | 700126 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 79 | 183522 | 183761 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 80 | 1024580 | 1024864 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 81 | 1428203 | 1428439 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 82 | 1300792 | 1301028 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 83 | 6312360 | 6312617 | - | NZ_CP034437.1 | Paenibacillus albus |
| 84 | 3047483 | 3047740 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 85 | 698664 | 698921 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 86 | 5076980 | 5077237 | - | NZ_CP009288.1 | Paenibacillus durus |
| 87 | 999369 | 999662 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 88 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 89 | 3480783 | 3481031 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 90 | 7170844 | 7171101 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 91 | 253262 | 253510 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 92 | 1515575 | 1515859 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 93 | 2799529 | 2799807 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 94 | 1722155 | 1722412 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 95 | 2933193 | 2933432 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 96 | 308489 | 308728 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 97 | 2260877 | 2261137 | - | NZ_CP034118.1 | Staphylospora marina |
| 98 | 5465455 | 5465721 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 99 | 919751 | 920008 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 100 | 6212618 | 6212875 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 101 | 923529 | 923786 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 102 | 6879669 | 6879926 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 103 | 787800 | 788099 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 104 | 1675772 | 1676047 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 105 | 2153510 | 2153752 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 106 | 1748031 | 1748288 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 107 | 3677262 | 3677501 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 108 | 2736745 | 2736984 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 109 | 515800 | 516039 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 110 | 1059483 | 1059770 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 111 | 3399658 | 3399945 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 112 | 6801406 | 6801654 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 113 | 404943 | 405233 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 114 | 1879318 | 1879575 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 115 | 567059 | 567337 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 116 | 2862953 | 2863213 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 117 | 5693287 | 5693544 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 118 | 2874281 | 2874541 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 119 | 2996580 | 2996819 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 120 | 445096 | 445344 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 121 | 6887100 | 6887357 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 122 | 2347892 | 2348167 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 123 | 4833346 | 4833603 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002939.5
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 0.76 | 94 | 1501.5 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 0.76 | 94 | 1501.5 | same-strand | GatB domain |
| 3 | PF01425.23 | 0.8 | 98 | 19.0 | same-strand | Amidase |
++ More..