Result : A7HMJ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000771.1 |
| Organism | Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) |
| Left | 1386702 |
| Right | 1386977 |
| Strand | + |
| Nucleotide Sequence | ATGTTAGAAGTTTGGAAAAAATGGAATGTAAGAGGTGTTGTTCAAGGTGTTGGTTTTCGCCATTTTGTCAAAAACGTTGCAAGAGCAATAGGTGTCAGAGGTTATGTGAAAAATGAAGACGATGGAAGTGTTACAATAGTTGCTGGAGGTAACGATGAGCAAATAAAAGAGCTCTTTAGAAGAATCATGGAAGGAAATGGTTGGAGTTACATTTCCGATTACGACGAAATTGATTTACCAAAACAAGAATACAAAGACTTTCATGTAGAATTTTAG |
| Sequence | MLEVWKKWNVRGVVQGVGFRHFVKNVARAIGVRGYVKNEDDGSVTIVAGGNDEQIKELFRRIMEGNGWSYISDYDEIDLPKQEYKDFHVEF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A7HMJ7 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1386702 | 1386977 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 2 | 1726993 | 1727268 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 3 | 1708366 | 1708593 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017095.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03313.17 | 0.67 | 2 | 5056.0 | opposite-strand | Serine dehydratase alpha chain |
| 2 | PF02219.19 | 1.0 | 3 | 4100 | opposite-strand | Methylenetetrahydrofolate reductase |
| 3 | PF01837.18 | 1.0 | 3 | 1814 | opposite-strand | Homocysteine biosynthesis enzyme, sulfur-incorporation |
| 4 | PF00037.29 | 1.0 | 3 | 1814 | opposite-strand | 4Fe-4S binding domain |
| 5 | PF12838.9 | 1.0 | 3 | 1814 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF14697.8 | 1.0 | 3 | 1814 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 1.0 | 3 | 1814 | opposite-strand | 4Fe-4S dicluster domain |
| 8 | PF00696.30 | 1.0 | 3 | 373 | opposite-strand | Amino acid kinase family |
| 9 | PF13840.8 | 1.0 | 3 | 373 | opposite-strand | ACT domain |
| 10 | PF00709.23 | 1.0 | 3 | 51 | same-strand | Adenylosuccinate synthetase |
| 11 | PF01927.18 | 1.0 | 3 | 1301 | same-strand | Mut7-C RNAse domain |
| 12 | PF14385.8 | 1.0 | 3 | 3297 | same-strand | Domain of unknown function (DUF4416) |
| 13 | PF00919.22 | 0.67 | 2 | 3750.0 | same-strand | Uncharacterized protein family UPF0004 |
| 14 | PF04055.23 | 0.67 | 2 | 3750.0 | same-strand | Radical SAM superfamily |
| 15 | PF18693.3 | 0.67 | 2 | 3750.0 | same-strand | TRAM domain |
| 16 | PF01938.22 | 0.67 | 2 | 3750.0 | same-strand | TRAM domain |
| 17 | PF14451.8 | 0.67 | 2 | 1307.0 | same-strand | Mut7-C ubiquitin |
| 18 | PF12837.9 | 0.67 | 2 | 1821.0 | opposite-strand | 4Fe-4S binding domain |
++ More..