Result : Q2JU22
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000239.1 |
| Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
| Left | 1649564 |
| Right | 1649779 |
| Strand | - |
| Nucleotide Sequence | ATGGTTTACGCTCGTCGCCGCCTGTCTCCCATCAAACCGGGAGAGCCGATCAAATACACCGATGTTGAGCTGCTCAAGAAATTTGTAACCGAGCGCGGCAAGATCCTGCCCCGCCGCATCACGGGGCTGACTGCCAAGCAGCAGCGGCAAGTCTCCAAAGCCATCAAACAAGCGCGCATCCTAGGCCTTCTCTACTTTGTCAACAAAGAAGGGTAA |
| Sequence | MVYARRRLSPIKPGEPIKYTDVELLKKFVTERGKILPRRITGLTAKQQRQVSKAIKQARILGLLYFVNKEG |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 18059494 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2JU22 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 104
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4849007 | 4849222 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 2 | 3098413 | 3098628 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 3 | 2509133 | 2509348 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 4 | 1420384 | 1420599 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 5 | 1648790 | 1649005 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 6 | 2909691 | 2909906 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 7 | 5297180 | 5297395 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 8 | 4486789 | 4487004 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 9 | 1066737 | 1066952 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 6120670 | 6120885 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 11 | 3314830 | 3315045 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 12 | 3459553 | 3459768 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 13 | 5906589 | 5906804 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 14 | 4251932 | 4252147 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 15 | 3711736 | 3711951 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 16 | 700843 | 701058 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 17 | 3692 | 3907 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 18 | 560867 | 561088 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 19 | 1392300 | 1392515 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 20 | 2309729 | 2309944 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 21 | 2142557 | 2142772 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 22 | 2336183 | 2336398 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 23 | 4721125 | 4721340 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 24 | 4405778 | 4405993 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 25 | 1898616 | 1898831 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 26 | 2489587 | 2489802 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 27 | 2361669 | 2361884 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 28 | 889807 | 890028 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 29 | 3609582 | 3609803 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 30 | 1067360 | 1067554 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 31 | 187650 | 187865 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 32 | 3252613 | 3252837 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 33 | 10147 | 10389 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 34 | 10358 | 10597 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 35 | 135242 | 135469 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 36 | 4185890 | 4186075 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 37 | 1044371 | 1044616 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 38 | 1415855 | 1416079 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 39 | 2868162 | 2868377 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 40 | 2368026 | 2368274 | - | NZ_CP072611.1 | Aureimonas populi |
| 41 | 1711118 | 1711333 | - | NZ_CP023671.1 | Clostridium septicum |
| 42 | 4124778 | 4124957 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 43 | 5447816 | 5448031 | - | NZ_CP020953.1 | Clostridium drakei |
| 44 | 4596241 | 4596456 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 45 | 4473562 | 4473777 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 46 | 748323 | 748547 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 47 | 3076309 | 3076524 | - | NZ_CP014204.2 | Clostridium baratii |
| 48 | 1091797 | 1092042 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 49 | 399597 | 399821 | - | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 50 | 3866525 | 3866749 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 51 | 1248774 | 1248998 | + | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 52 | 1136749 | 1136973 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 53 | 2805029 | 2805244 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 54 | 945769 | 945999 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 55 | 2570953 | 2571183 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 56 | 599462 | 599692 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 57 | 1075767 | 1075997 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 58 | 257597 | 257821 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 59 | 1125158 | 1125352 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 60 | 2979353 | 2979577 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 61 | 1433893 | 1434117 | + | NZ_AP017655.1 | Sphingobium cloacae |
| 62 | 1349622 | 1349846 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 63 | 10127 | 10351 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 64 | 1583614 | 1583838 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 65 | 615135 | 615359 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 66 | 522736 | 522960 | + | NZ_CP041659.1 | Sphingomonas xanthus |
| 67 | 1980667 | 1980891 | + | NZ_CP060718.1 | Sphingomonas lutea |
| 68 | 978452 | 978676 | + | NZ_CP009571.1 | Sphingomonas taxi |
| 69 | 1260438 | 1260668 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 70 | 81753 | 81977 | - | NC_009511.1 | Sphingomonas wittichii RW1 |
| 71 | 1776665 | 1776889 | + | NZ_CP042306.1 | Sphingomonas panacisoli |
| 72 | 1269219 | 1269443 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 73 | 5092389 | 5092604 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 74 | 4472519 | 4472764 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 75 | 2699284 | 2699514 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 76 | 3929923 | 3930102 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 77 | 5924001 | 5924216 | - | NZ_CP043998.1 | Clostridium diolis |
| 78 | 6514802 | 6515017 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 79 | 1607257 | 1607481 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 80 | 1769560 | 1769760 | - | NZ_CP013742.1 | Legionella pneumophila |
| 81 | 3764794 | 3765009 | + | NZ_CP030775.1 | Clostridium butyricum |
| 82 | 3790018 | 3790233 | - | NZ_CP040924.1 | Clostridium thermarum |
| 83 | 2493317 | 2493556 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 84 | 2244476 | 2244700 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 85 | 61514 | 61699 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 86 | 4344048 | 4344290 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 87 | 44465 | 44650 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 88 | 59833 | 60018 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 89 | 57086 | 57271 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 90 | 60310 | 60495 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 91 | 84177 | 84362 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 92 | 206949 | 207134 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 93 | 139610 | 139831 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 94 | 357616 | 357801 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 95 | 848003 | 848227 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 96 | 863566 | 863790 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
| 97 | 5143964 | 5144188 | + | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 98 | 1954627 | 1954860 | + | NZ_CP017688.1 | Flavobacterium crassostreae |
| 99 | 2199336 | 2199569 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 100 | 932759 | 932992 | - | NZ_CP012898.1 | Algibacter alginicilyticus |
| 101 | 1135268 | 1135501 | - | NZ_CP025791.1 | Flavivirga eckloniae |
| 102 | 3358557 | 3358790 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 103 | 3278133 | 3278366 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 104 | 1132331 | 1132570 | + | NC_015321.1 | Fluviicola taffensis DSM 16823 |
| 105 | 1792590 | 1792763 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029477.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01250.19 | 0.68 | 71 | 66 | same-strand | Ribosomal protein S6 |
| 2 | PF03948.16 | 0.65 | 68 | 15.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 3 | PF01281.21 | 0.65 | 68 | 15.0 | same-strand | Ribosomal protein L9, N-terminal domain |
++ More..