Result : Q2JS36
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein L (PSII-L) |
| NCBI Accession ID | CP000239.1 |
| Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
| Left | 2437096 |
| Right | 2437221 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGATCAACCTGAGAAGAATCCCAACACCCAGCCGGTAGAGCTAAACCGCACCTCCCTATACTTGGGCTTGCTGCTGGTGTTTGTGGTGGGGCTGTTGTTTTCCAGCTACTTTCTCAACTGA |
| Sequence | MADQPEKNPNTQPVELNRTSLYLGLLLVFVVGLLFSSYFLN |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface and is required for correct PSII assembly and/or dimerization. {ECO:0000255|HAMAP-Rule:MF_01317}. |
| Pubmed ID | 18059494 |
| Domain | CDD:421499 |
| Functional Category | Others |
| Uniprot ID | Q2JS36 |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2182610 | 2182735 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 2 | 3739944 | 3740066 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 3 | 2274693 | 2274812 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 4 | 1312666 | 1312785 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 5 | 978473 | 978592 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 6 | 3375545 | 3375664 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 7 | 2067683 | 2067802 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 8 | 1432419 | 1432547 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 9 | 969622 | 969741 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 10 | 856236 | 856355 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 11 | 4890255 | 4890374 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 12 | 975099 | 975218 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 13 | 2668387 | 2668503 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 14 | 4983933 | 4984052 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 15 | 2999961 | 3000083 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 16 | 2035903 | 2036025 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 17 | 4428996 | 4429118 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 18 | 1496479 | 1496601 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 19 | 3386323 | 3386445 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 20 | 905118 | 905237 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 21 | 6854479 | 6854601 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 22 | 5254262 | 5254384 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 23 | 3491870 | 3491992 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 24 | 3587183 | 3587302 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 25 | 1488276 | 1488389 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 26 | 1610729 | 1610842 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 27 | 3372707 | 3372820 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 28 | 3012113 | 3012232 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 29 | 906143 | 906256 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 30 | 319009 | 319128 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 31 | 1353982 | 1354095 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019729.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00283.21 | 1.0 | 31 | 153 | same-strand | Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits |
| 2 | PF00284.22 | 1.0 | 31 | 168 | same-strand | Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit |
| 3 | PF14870.8 | 0.87 | 27 | 525 | same-strand | Photosynthesis system II assembly factor YCF48 |
| 4 | PF00301.22 | 0.87 | 27 | 1642 | same-strand | Rubredoxin |
| 5 | PF01788.19 | 0.68 | 21 | 48 | same-strand | PsbJ |
++ More..