Result : Q2JRP9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NAD(P)H-quinone oxidoreductase subunit L (EC 7.1.1.-) (NAD(P)H dehydrogenase I subunit L) (NDH-1 subunit L) (NDH-L) |
| NCBI Accession ID | CP000239.1 |
| Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
| Left | 2603363 |
| Right | 2603584 |
| Strand | - |
| Nucleotide Sequence | ATGCTCTCTACCTCGACACTCATTGGCTTGACCTATGCTGCGCTAGCAGTTCTCTACCTGCTGGTGCTGCCGTTCTTGTTTTTGGTGTACGTGGACAAGCGCTGGAACTACAGCGGTGCCTGGGAAAAGGTGTTGATGTTTTTCCTAGTTTTGTTTTTCTTCCCCGGTATGGTGCTCGTGGCTCCCTTCATGACGTTTCGGCCCAAGCCGCGTTCGCTCTAG |
| Sequence | MLSTSTLIGLTYAALAVLYLLVLPFLFLVYVDKRWNYSGAWEKVLMFFLVLFFFPGMVLVAPFMTFRPKPRSL |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. {ECO:0000255|HAMAP-Rule:MF_01355}. |
| Pubmed ID | 18059494 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q2JRP9 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2399269 | 2399454 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 2 | 724962 | 725147 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 3 | 1139415 | 1139612 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 4 | 7139182 | 7139367 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 5 | 3606286 | 3606516 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00805.24 | 0.6 | 3 | 1917 | opposite-strand | Pentapeptide repeats (8 copies) |
| 2 | PF13599.8 | 0.6 | 3 | 1917 | opposite-strand | Pentapeptide repeats (9 copies) |
| 3 | PF13576.8 | 0.6 | 3 | 1917 | opposite-strand | Pentapeptide repeats (9 copies) |
| 4 | PF02446.19 | 0.6 | 3 | 364 | same-strand | 4-alpha-glucanotransferase |
| 5 | PF11460.10 | 1.0 | 5 | 6 | same-strand | Protein of unknown function (DUF3007) |
| 6 | PF01058.24 | 0.6 | 3 | 84 | same-strand | NADH ubiquinone oxidoreductase, 20 Kd subunit |
| 7 | PF01112.20 | 0.6 | 3 | 918 | same-strand | Asparaginase |
++ More..