Result : Q2JQD1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | CP000239.1 |
| Organism | Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime) |
| Left | 2616763 |
| Right | 2617065 |
| Strand | + |
| Nucleotide Sequence | ATGGCGGAACGGTCGGATCCCTTGACTCGCGGTTTAGTTGCCCTGATTCGAGGCTACCAGGTGGCCATCTCCCCTCTGCTACCGCCTGCCTGCCGCTACTACCCCACCTGCTCCCAGTACACCCTGGAAGCCGTGCGGCGCTACGGTGCCATCCGAGGCAGTTGGCTGGGGATCCGCCGCCTCTGCCGCTGCCACCCTTGGCACCCGGGAGGCTACGACCCGGTGCCCGACTTGCCGGGATCCGCACCCGAGGAAAACGGTCGCCCCAGCCCAGATGGCCAACATTCTGGATCTGGGGGTTGA |
| Sequence | MAERSDPLTRGLVALIRGYQVAISPLLPPACRYYPTCSQYTLEAVRRYGAIRGSWLGIRRLCRCHPWHPGGYDPVPDLPGSAPEENGRPSPDGQHSGSGG |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 18059494 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q2JQD1 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 120
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1613898 | 1614161 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 2 | 1767472 | 1767726 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 3 | 3810903 | 3811157 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 4 | 1863616 | 1863873 | - | NC_017856.1 | Methylophaga frappieri |
| 5 | 2019453 | 2019701 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 6 | 1740556 | 1740810 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 7 | 3810120 | 3810374 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 8 | 4617056 | 4617313 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 9 | 4569798 | 4570055 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 10 | 2442168 | 2442437 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 11 | 31338 | 31598 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 12 | 5687792 | 5688052 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 13 | 403553 | 403834 | - | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 14 | 2406778 | 2407062 | + | NZ_CP029843.1 | Lysobacter maris |
| 15 | 2345353 | 2345646 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 16 | 4606018 | 4606275 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 17 | 656334 | 656591 | + | NZ_LR134378.1 | Lautropia mirabilis |
| 18 | 1304813 | 1305070 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 19 | 2454878 | 2455129 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 20 | 3388377 | 3388634 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 21 | 4144754 | 4145011 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 22 | 4305740 | 4305997 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 23 | 48408 | 48665 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 24 | 4002978 | 4003235 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 25 | 50046 | 50303 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 26 | 4691231 | 4691488 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 27 | 2536329 | 2536625 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 28 | 3213546 | 3213803 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 29 | 5414819 | 5415076 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 30 | 5315244 | 5315501 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 31 | 476539 | 476796 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 32 | 3121188 | 3121445 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 33 | 4879155 | 4879412 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 34 | 3628166 | 3628468 | - | NZ_CP011502.1 | Aeromicrobium erythreum |
| 35 | 3427535 | 3427792 | - | NZ_CP038469.1 | Citrobacter tructae |
| 36 | 2417996 | 2418253 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 37 | 2666781 | 2667038 | + | NZ_CP033744.1 | Citrobacter freundii |
| 38 | 4671174 | 4671431 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 39 | 3092149 | 3092391 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 40 | 5189132 | 5189389 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 41 | 3289160 | 3289453 | + | NZ_CP017715.1 | Marinobacter salinus |
| 42 | 4684307 | 4684564 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 43 | 3943373 | 3943633 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 44 | 4071787 | 4072044 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 45 | 4448647 | 4448904 | - | NZ_LR134340.1 | Escherichia marmotae |
| 46 | 2449458 | 2449715 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 47 | 1855579 | 1855836 | + | NZ_CP053416.1 | Salmonella bongori |
| 48 | 2888876 | 2889133 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 49 | 4634514 | 4634771 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 50 | 3884816 | 3885073 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 51 | 3859414 | 3859671 | + | NZ_AP014857.1 | Escherichia albertii |
| 52 | 4709704 | 4709961 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 53 | 48967 | 49224 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 54 | 4747406 | 4747663 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 55 | 4811953 | 4812210 | - | NC_015968.1 | Enterobacter soli |
| 56 | 2582500 | 2582757 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 57 | 4847429 | 4847686 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 58 | 3233296 | 3233553 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 59 | 4046178 | 4046435 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 60 | 3565559 | 3565816 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 61 | 1367078 | 1367335 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 62 | 5110091 | 5110348 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 63 | 4261530 | 4261787 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 64 | 456657 | 456914 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 65 | 48532 | 48789 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 66 | 6182251 | 6182508 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 67 | 3796307 | 3796582 | + | NZ_CP023465.1 | Lysobacter capsici |
| 68 | 5241329 | 5241586 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 69 | 5300710 | 5300967 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 70 | 5540913 | 5541170 | - | NZ_CP054254.1 | Klebsiella variicola |
| 71 | 3444353 | 3444613 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 72 | 6605086 | 6605328 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 73 | 10340254 | 10340532 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 74 | 9359405 | 9359674 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 75 | 4776778 | 4777035 | - | NZ_LR134201.1 | Cedecea lapagei |
| 76 | 1732750 | 1733007 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 77 | 7119221 | 7119463 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 78 | 3486254 | 3486511 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 79 | 4771184 | 4771441 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 80 | 1722742 | 1722999 | + | NZ_CP026047.1 | Raoultella planticola |
| 81 | 5574299 | 5574556 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 82 | 1226279 | 1226536 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 83 | 4564821 | 4565078 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 84 | 3001976 | 3002230 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 85 | 1568150 | 1568398 | - | NZ_CP026364.1 | Proteus hauseri |
| 86 | 336119 | 336394 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 87 | 5597097 | 5597354 | - | NZ_CP050508.1 | Raoultella terrigena |
| 88 | 4278334 | 4278588 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 89 | 4304763 | 4305005 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 90 | 5265069 | 5265326 | - | NZ_CP041247.1 | Raoultella electrica |
| 91 | 1145931 | 1146188 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 92 | 4127321 | 4127599 | - | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 93 | 5637460 | 5637813 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 94 | 4110147 | 4110443 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 95 | 646126 | 646395 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 96 | 4653160 | 4653423 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 97 | 5176860 | 5177117 | - | NZ_CP023525.1 | Cedecea neteri |
| 98 | 4821722 | 4821982 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 99 | 1649313 | 1649582 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 100 | 5606245 | 5606487 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 101 | 2115209 | 2115466 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 102 | 499897 | 500175 | + | NZ_LT906453.1 | Dermatophilus congolensis |
| 103 | 959186 | 959500 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 104 | 5242384 | 5242722 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
| 105 | 10928391 | 10928636 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 106 | 153754 | 154026 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 107 | 652557 | 652808 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 108 | 6833 | 7117 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 109 | 3208452 | 3208694 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 110 | 3465812 | 3466069 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 111 | 5602841 | 5603092 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 112 | 6513787 | 6514062 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 113 | 2391516 | 2391767 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 114 | 4385565 | 4385819 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 115 | 4564699 | 4564983 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 116 | 2369833 | 2370093 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 117 | 5321342 | 5321623 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 118 | 4998341 | 4998634 | - | NZ_CP053986.1 | Achromobacter denitrificans |
| 119 | 2681162 | 2681425 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 120 | 927371 | 927667 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 121 | 2875866 | 2876132 | - | NZ_CP016268.1 | Woeseia oceani |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP006664.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12631.9 | 0.62 | 74 | 1753 | same-strand | MnmE helical domain |
| 2 | PF10396.11 | 0.62 | 74 | 1753 | same-strand | GTP-binding protein TrmE N-terminus |
| 3 | PF14849.8 | 0.67 | 80 | 3 | same-strand | YidC periplasmic domain |
| 4 | PF02096.22 | 0.82 | 98 | 3 | same-strand | 60Kd inner membrane protein |
| 5 | PF00825.20 | 0.65 | 78 | -36 | same-strand | Ribonuclease P |
++ More..