| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000240.1 |
| Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left | 333559 |
| Right | 333861 |
| Strand | + |
| Nucleotide Sequence | ATGCTCCTCGATTTTTTGGATCAGCTTTTTTCTCGGCACTCCGGCAACAGCCGCCAGCAAGCCAAGCAACGGTTGAAGCTGATCTTGGCCCATGACCGCGCTGACCTCACCCCGGCGGCGCTGGAATCAATGCGCCTGGAGATTTTGGGGGTGGTGTCCCGCTATGTGGAGCTGGATTCAGAAGGGATGCAGTTTCACTTGGCCACGGAAGGGGGAACGACTGCTCTTATTGCCAATCTGCCTATCCGTCGCGTTAAGCCCTTAGAGACCGGTCTCAGCCGCTCAGAAGGCGAGAAAGCCTAG |
| Sequence | MLLDFLDQLFSRHSGNSRQQAKQRLKLILAHDRADLTPAALESMRLEILGVVSRYVELDSEGMQFHLATEGGTTALIANLPIRRVKPLETGLSRSEGEKA |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 18059494 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q2JPH1 |
| ORF Length (Amino Acid) | 100 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4265680 | 4265970 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 2 | 4596955 | 4597245 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 3 | 4964878 | 4965168 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 4 | 1111146 | 1111448 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 5 | 1972105 | 1972380 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 6 | 2072381 | 2072683 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 7 | 4591323 | 4591622 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 8 | 5625613 | 5625906 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 9 | 2743351 | 2743653 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 10 | 680735 | 680995 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 11 | 3554117 | 3554422 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 12 | 3440397 | 3440681 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 13 | 132206 | 132523 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 14 | 3559502 | 3559789 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 15 | 444585 | 444878 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 16 | 387987 | 388277 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 17 | 3371434 | 3371727 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07005.13 | 0.71 | 12 | 2114.5 | same-strand | Sugar-binding N-terminal domain |
| 2 | PF17042.7 | 0.71 | 12 | 2114.5 | same-strand | Nucleotide-binding C-terminal domain |
| 3 | PF03775.18 | 1.0 | 17 | 914 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 4 | PF01656.25 | 1.0 | 17 | 37 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF10609.11 | 0.94 | 16 | 37.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 6 | PF13614.8 | 1.0 | 17 | 37 | same-strand | AAA domain |
| 7 | PF06564.14 | 0.65 | 11 | 37 | same-strand | Cellulose biosynthesis protein BcsQ |