Result : Q2JNW5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I iron-sulfur center (EC 1.97.1.12) (9 kDa polypeptide) (PSI-C) (Photosystem I subunit VII) (PsaC) |
| NCBI Accession ID | CP000240.1 |
| Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left | 561039 |
| Right | 561287 |
| Strand | - |
| Nucleotide Sequence | ATGGCTCACTCGGTCAAGATCTACGACACCTGCATCGGCTGCACTCAGTGTGTGCGGGCTTGTCCCACCGACGTGTTGGAGATGGTGCCCTGGAAGGGGAACAACAAGGCTGGCATGATCGCTGCCGCTCCCCGCACCGAAGACTGCGTTGGCTGCAAACGCTGTGAAACCGCTTGTCCCACCGATTTTCTGAGCATCCGAGTCTACCTTGGCCCCGAAACCACCCGCAGCATGGGCTTAGCCTACTGA |
| Sequence | MAHSVKIYDTCIGCTQCVRACPTDVLEMVPWKGNNKAGMIAAAPRTEDCVGCKRCETACPTDFLSIRVYLGPETTRSMGLAY |
| Source of smORF | Swiss-Prot |
| Function | Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin/cytochrome c6-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn. {ECO:0000255|HAMAP-Rule:MF_01303}. |
| Pubmed ID | 18059494 |
| Domain | CDD:403902,CDD:418523 |
| Functional Category | Metal-binding |
| Uniprot ID | Q2JNW5 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2374670 | 2374915 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 2 | 3491278 | 3491523 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 3 | 4231102 | 4231347 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 4 | 907703 | 907948 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 5 | 1039161 | 1039406 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 6 | 1120937 | 1121182 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 7 | 1638044 | 1638289 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 8 | 2589909 | 2590154 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 9 | 434087 | 434332 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 10 | 630122 | 630367 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 11 | 6372291 | 6372536 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 12 | 4108831 | 4109076 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 13 | 3317619 | 3317864 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 14 | 3192338 | 3192583 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 15 | 5342383 | 5342628 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 16 | 376197 | 376442 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 17 | 2927402 | 2927647 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 18 | 1264553 | 1264798 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 19 | 1622219 | 1622464 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 20 | 318846 | 319091 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 21 | 883514 | 883759 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 22 | 2835668 | 2835913 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 23 | 6451893 | 6452138 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 24 | 1460897 | 1461142 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 25 | 3653916 | 3654161 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 26 | 4526898 | 4527143 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 27 | 5634139 | 5634384 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 28 | 5531933 | 5532178 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 29 | 5460868 | 5461113 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 30 | 2113537 | 2113782 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 31 | 3266486 | 3266731 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
++ More..