Result : Q2JNH2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000240.1 |
| Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left | 726365 |
| Right | 726649 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGACAGGGTTCGCGTTCACGTCTGGATACGGGGGCGGGTTCAGGGCGTGGGGTTTCGCGCCCACACCGAAGCGATGGCTCTCCATGCGGGTGTTCAAGGGTGGGTGCGCAATTTGCGGGATGGTCGTGTAGAGGCTGTTTTTGAAGGATCCCCTGCCGCAGTGGAGGCGATGCTGCGCTGGTGCCAACAGGGCAGCCCCGGTTCGGTTGTGGAGGCCATTGAGCAACGTTCCGAGCCGCCGGAAGGTCTACCCACTTTTGAGATTCGCCCTACCGTTTGA |
| Sequence | MSDRVRVHVWIRGRVQGVGFRAHTEAMALHAGVQGWVRNLRDGRVEAVFEGSPAAVEAMLRWCQQGSPGSVVEAIEQRSEPPEGLPTFEIRPTV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 18059494 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q2JNH2 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 142
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 316119 | 316397 | + | NZ_CP058334.1 | Natronomonas halophila |
| 2 | 1481506 | 1481787 | + | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 3 | 662594 | 662872 | + | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 4 | 296255 | 296533 | + | NZ_CP058335.1 | Natronomonas salina |
| 5 | 1641433 | 1641711 | - | NZ_CP019327.1 | Haloterrigena daqingensis |
| 6 | 1809538 | 1809816 | - | NC_007426.1 | Natronomonas pharaonis DSM 2160 |
| 7 | 5275916 | 5276194 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 8 | 1087210 | 1087458 | + | NZ_CP082286.1 | Halobaculum roseum |
| 9 | 800190 | 800468 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 10 | 2309920 | 2310198 | - | NC_013202.1 | Halomicrobium mukohataei DSM 12286 |
| 11 | 1826419 | 1826697 | + | NC_020388.1 | Natronomonas moolapensis 8.8.11 |
| 12 | 717489 | 717767 | - | NZ_CP065856.1 | Halosimplex litoreum |
| 13 | 260265 | 260540 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 14 | 515305 | 515541 | - | NC_013922.1 | Natrialba magadii ATCC 43099 |
| 15 | 1451253 | 1451531 | + | NZ_LN831302.1 | Halobacterium hubeiense |
| 16 | 4197205 | 4197444 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 17 | 2301379 | 2301657 | + | NZ_CP031305.1 | Natronorubrum bangense |
| 18 | 2084495 | 2084773 | - | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 19 | 106467 | 106745 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 20 | 1329007 | 1329285 | + | NC_019974.1 | Natronococcus occultus SP4 |
| 21 | 413589 | 413867 | - | NZ_CP071463.1 | Haloterrigena longa |
| 22 | 2026724 | 2027002 | + | NZ_CP058910.1 | Halosimplex rubrum |
| 23 | 2514402 | 2514680 | + | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 24 | 1432126 | 1432404 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 25 | 1143092 | 1143328 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
| 26 | 1553947 | 1554228 | - | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 27 | 1570245 | 1570499 | + | NZ_CP058529.1 | Halobaculum halophilum |
| 28 | 331905 | 332180 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 29 | 690977 | 691255 | + | NZ_CP016804.1 | Halodesulfurarchaeum formicicum |
| 30 | 2815366 | 2815602 | + | NZ_AP017558.1 | Halopenitus persicus |
| 31 | 547332 | 547577 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 32 | 591286 | 591516 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 33 | 1956938 | 1957225 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 34 | 2811982 | 2812260 | - | NZ_CP031150.1 | Haloplanus rubicundus |
| 35 | 1672254 | 1672547 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 36 | 325427 | 325705 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 37 | 3069271 | 3069549 | - | NZ_CP034345.1 | Haloplanus rallus |
| 38 | 2148265 | 2148543 | + | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 39 | 3016531 | 3016809 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 40 | 301217 | 301474 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 41 | 1756618 | 1756854 | - | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 42 | 1003448 | 1003726 | - | NZ_CP040637.1 | Natrinema pallidum |
| 43 | 1717367 | 1717639 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 44 | 2444210 | 2444488 | - | NZ_CP034145.1 | Haloplanus aerogenes |
| 45 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 46 | 1441081 | 1441359 | - | NZ_CP034940.1 | Halorubrum ezzemoulense |
| 47 | 1098348 | 1098578 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 48 | 1043318 | 1043572 | + | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 49 | 1177737 | 1178015 | + | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 50 | 887473 | 887727 | - | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 51 | 1766941 | 1767186 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 52 | 2030323 | 2030571 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 53 | 5776969 | 5777202 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 54 | 2190673 | 2190951 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 55 | 1721803 | 1722078 | + | NC_014297.1 | Halalkalicoccus jeotgali B3 |
| 56 | 1716345 | 1716620 | + | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 57 | 2617889 | 2618167 | - | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 58 | 1224313 | 1224546 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 59 | 2073669 | 2073947 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 60 | 642080 | 642334 | + | NC_008212.1 | Haloquadratum walsbyi DSM 16790 |
| 61 | 4511499 | 4511777 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 62 | 373976 | 374254 | - | NC_019792.1 | Natronobacterium gregoryi SP2 |
| 63 | 1279029 | 1279313 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 64 | 1691148 | 1691396 | - | NZ_CP058579.1 | Halobaculum salinum |
| 65 | 2068781 | 2069065 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 66 | 1297338 | 1297622 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 67 | 1569939 | 1570211 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 68 | 1374256 | 1374537 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 69 | 1681127 | 1681402 | + | NZ_CP019154.1 | Haloarcula taiwanensis |
| 70 | 1944897 | 1945178 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 71 | 955028 | 955306 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 72 | 4887876 | 4888124 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 73 | 1469751 | 1470032 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 74 | 3357232 | 3357510 | - | NZ_CP069188.1 | Haloterrigena salifodinae |
| 75 | 2132831 | 2133076 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 76 | 822030 | 822311 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 77 | 128894 | 129145 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 78 | 6208340 | 6208624 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 79 | 4036009 | 4036308 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 80 | 296385 | 296666 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 81 | 1616022 | 1616288 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 82 | 943846 | 944121 | - | NZ_CP014750.1 | Thermococcus peptonophilus |
| 83 | 2913677 | 2913949 | + | NZ_CP038266.1 | Microbacterium wangchenii |
| 84 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 85 | 1355157 | 1355429 | + | NZ_CP014855.1 | Thermococcus gorgonarius |
| 86 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 87 | 2435183 | 2435476 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 88 | 2167167 | 2167415 | + | NC_016645.1 | Pyrobaculum ferrireducens |
| 89 | 1809391 | 1809669 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 90 | 1520142 | 1520378 | - | NZ_CP015101.1 | Thermococcus barossii |
| 91 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 92 | 1539702 | 1539947 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 93 | 1216508 | 1216783 | + | NZ_CP014854.1 | Thermococcus celer Vu 13 = JCM 8558 |
| 94 | 2580910 | 2581176 | + | NZ_CP031423.1 | Microbacterium lemovicicum |
| 95 | 7676007 | 7676249 | + | NZ_CP023691.1 | Streptomyces platensis |
| 96 | 293690 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 97 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 98 | 2060248 | 2060529 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 99 | 1383091 | 1383366 | - | NZ_CP015106.1 | Thermococcus radiotolerans |
| 100 | 4130167 | 4130409 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 101 | 1960952 | 1961227 | + | NZ_CP014862.1 | Thermococcus profundus |
| 102 | 2096369 | 2096641 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 103 | 330048 | 330323 | - | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 104 | 4471941 | 4472234 | + | NZ_CP016616.1 | Microvirga ossetica |
| 105 | 1953996 | 1954229 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 106 | 638126 | 638404 | + | NZ_CP070326.1 | Streptomyces noursei |
| 107 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 108 | 1813627 | 1813893 | - | NZ_LR881183.1 | Thermococcus camini |
| 109 | 1566756 | 1567025 | + | NZ_CP062310.1 | Infirmifilum lucidum |
| 110 | 2441747 | 2442016 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 111 | 2899509 | 2899793 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 112 | 723746 | 723994 | + | NC_003364.1 | Pyrobaculum aerophilum str. IM2 |
| 113 | 284384 | 284650 | + | NZ_CP035491.1 | Agromyces protaetiae |
| 114 | 270758 | 271033 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 115 | 1643552 | 1643818 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 116 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 117 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 118 | 831132 | 831368 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 119 | 549583 | 549816 | + | NC_012669.1 | Beutenbergia cavernae DSM 12333 |
| 120 | 1057880 | 1058164 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 121 | 1210855 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 122 | 2671899 | 2672153 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 123 | 879875 | 880159 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 124 | 276885 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 125 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 126 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 127 | 928066 | 928320 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 128 | 1356786 | 1357019 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 129 | 1792169 | 1792408 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 130 | 35519 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 131 | 892253 | 892519 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 132 | 2625553 | 2625825 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 133 | 773802 | 774074 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 134 | 2980922 | 2981188 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 135 | 3781863 | 3782129 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 136 | 3338024 | 3338263 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 137 | 2815472 | 2815738 | + | NZ_CP044232.1 | Microbacterium lushaniae |
| 138 | 301821 | 302096 | - | NZ_CP015103.1 | Thermococcus siculi |
| 139 | 286000 | 286236 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 140 | 1711990 | 1712265 | - | NZ_CP007264.1 | Thermococcus nautili |
| 141 | 1621563 | 1621841 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 142 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
++ More..