Result : Q2JL69
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L31 |
| NCBI Accession ID | CP000240.1 |
| Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left | 1656220 |
| Right | 1656444 |
| Strand | + |
| Nucleotide Sequence | ATGCCCAAGAAAGGATTGCACCCGCAGTGGTATCCAGAAGCCAAAGTCATCTGCAATGGCGAAGTGGTGATGACGGTGGGATCCACCAAGCCGGAGCTCAAGGTGGATGTTTGGTCGGGCAACCATCCCTTTTTCACCGGCAGCCAGAAGATCATCGACAGCGAAGGCCGGGTGGAGAAGTTCATGCGCAAATACGGCATGAGCGGTGGCAAAAAGGCCAAGTAG |
| Sequence | MPKKGLHPQWYPEAKVICNGEVVMTVGSTKPELKVDVWSGNHPFFTGSQKIIDSEGRVEKFMRKYGMSGGKKAK |
| Source of smORF | Swiss-Prot |
| Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
| Pubmed ID | 18059494 |
| Domain | CDD:412343 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q2JL69 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 143
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3776290 | 3776520 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 2 | 2680829 | 2681062 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 3 | 3406006 | 3406248 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 4 | 205590 | 205841 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 4569861 | 4570106 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 6 | 5479918 | 5480169 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 7 | 163080 | 163313 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 8 | 6449573 | 6449809 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 9 | 2182593 | 2182832 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 10 | 633263 | 633499 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 11 | 2606357 | 2606605 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 12 | 1955523 | 1955741 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 13 | 1935213 | 1935443 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 14 | 4012134 | 4012376 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 15 | 5639513 | 5639755 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 16 | 5450192 | 5450434 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 17 | 6160484 | 6160726 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 18 | 4152417 | 4152668 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 19 | 4480604 | 4480840 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 20 | 1233999 | 1234256 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 21 | 5554099 | 5554338 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 22 | 3750032 | 3750283 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 23 | 4815894 | 4816127 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 24 | 849053 | 849247 | - | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 25 | 2225728 | 2225952 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 26 | 545223 | 545405 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 27 | 1528076 | 1528291 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 28 | 2233108 | 2233317 | + | NC_008593.1 | Clostridium novyi NT |
| 29 | 1519904 | 1520122 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 30 | 180423 | 180641 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 31 | 616136 | 616327 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 32 | 266167 | 266382 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 33 | 580771 | 580959 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 34 | 277860 | 278072 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 35 | 1072671 | 1072889 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 36 | 977005 | 977217 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 37 | 250819 | 251001 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 38 | 2269550 | 2269759 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 39 | 2492815 | 2493033 | - | NC_017790.1 | Deinococcus gobiensis I-0 |
| 40 | 740646 | 740864 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 41 | 1769365 | 1769583 | - | NZ_CP021081.1 | Deinococcus ficus |
| 42 | 3105812 | 3106012 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 43 | 3020862 | 3021074 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 44 | 153681 | 153893 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 45 | 1364026 | 1364226 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 46 | 1440426 | 1440626 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 47 | 1485495 | 1485695 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 48 | 151583 | 151795 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 49 | 34989 | 35183 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 50 | 1578851 | 1579036 | - | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 51 | 2509789 | 2509995 | + | NZ_HG917868.1 | Clostridium bornimense |
| 52 | 803866 | 804087 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 53 | 1571280 | 1571489 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 54 | 622036 | 622239 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 55 | 1442017 | 1442217 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 56 | 1221843 | 1222028 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 57 | 1792436 | 1792645 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 58 | 1776575 | 1776784 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 59 | 1164004 | 1164213 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 60 | 551102 | 551311 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 61 | 1121292 | 1121501 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 62 | 1552901 | 1553101 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 63 | 815659 | 815877 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 64 | 1699374 | 1699583 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 65 | 2684425 | 2684643 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 66 | 797680 | 797901 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 67 | 343513 | 343716 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 68 | 158139 | 158339 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 69 | 1084377 | 1084577 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 70 | 3127497 | 3127712 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 71 | 484923 | 485123 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 72 | 1671901 | 1672101 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 73 | 1321513 | 1321713 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 74 | 2136929 | 2137129 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 75 | 1371347 | 1371547 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 76 | 161203 | 161403 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 77 | 1756846 | 1757049 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 78 | 716973 | 717182 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 79 | 1942671 | 1942886 | + | NZ_CP016312.1 | Thermus brockianus |
| 80 | 3253272 | 3253478 | - | NC_014624.2 | Eubacterium callanderi |
| 81 | 4116971 | 4117177 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 82 | 1929519 | 1929725 | + | NZ_CP019962.1 | Eubacterium limosum |
| 83 | 1476986 | 1477186 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 84 | 1350715 | 1350930 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 85 | 773048 | 773263 | - | NZ_CP038452.1 | Thermus caldilimi |
| 86 | 1605191 | 1605391 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 87 | 288246 | 288446 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 88 | 125908 | 126111 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 89 | 442535 | 442744 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 90 | 1690487 | 1690690 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 91 | 808927 | 809139 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 92 | 2245450 | 2245650 | + | NZ_CP012543.1 | Campylobacter rectus |
| 93 | 1044840 | 1045055 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 94 | 1828725 | 1828925 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 95 | 260401 | 260601 | + | NZ_CP059443.1 | Campylobacter fetus |
| 96 | 1453443 | 1453643 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 97 | 216301 | 216501 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 98 | 1958555 | 1958755 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 99 | 309421 | 309621 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 100 | 4722053 | 4722250 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 101 | 2475115 | 2475315 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 102 | 223483 | 223683 | - | NZ_CP012544.1 | Campylobacter showae |
| 103 | 3955895 | 3956125 | - | NZ_CP061800.1 | Desulfonema magnum |
| 104 | 973746 | 973949 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 105 | 246318 | 246518 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 106 | 4546456 | 4546659 | - | NZ_CP039126.1 | Blautia producta |
| 107 | 440953 | 441156 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 108 | 103778 | 103978 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 109 | 4712956 | 4713156 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 110 | 192391 | 192591 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 111 | 967991 | 968206 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 112 | 4325430 | 4325639 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 113 | 798306 | 798512 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 114 | 217135 | 217341 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 115 | 2530288 | 2530485 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 116 | 4520708 | 4520917 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 117 | 358616 | 358819 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 118 | 797629 | 797829 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 119 | 1022074 | 1022265 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 120 | 848075 | 848281 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 121 | 501558 | 501764 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 122 | 3913377 | 3913586 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 123 | 465577 | 465777 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 124 | 1279501 | 1279701 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 125 | 110190 | 110390 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 126 | 1670759 | 1670965 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 127 | 997696 | 997926 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 128 | 64081 | 64284 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 129 | 8834031 | 8834240 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 130 | 54487 | 54687 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 131 | 2989595 | 2989798 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 132 | 1750158 | 1750343 | - | NZ_CP016210.1 | Azoarcus olearius |
| 133 | 356468 | 356665 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 134 | 877072 | 877275 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 135 | 926117 | 926320 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 136 | 1193508 | 1193726 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 137 | 1833113 | 1833319 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 138 | 1218284 | 1218490 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 139 | 2471234 | 2471443 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 140 | 517974 | 518186 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 141 | 2411565 | 2411777 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 142 | 395533 | 395739 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 143 | 2209824 | 2210045 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
++ More..