| Protein name |
Photosystem I reaction center subunit XII (PSI-M) |
| NCBI Accession ID |
CP000240.1 |
| Organism |
Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left |
2911524 |
| Right |
2911616 |
| Strand |
- |
| Nucleotide Sequence |
ATGACGGACGCACAAGTTTTCACCATCCTGGCGATTGCCTTGGTGCCGGCAGTGATGGCTCTGCTTTTGGGATCCGCCCTGGCCCGCAGCTAA |
| Sequence |
MTDAQVFTILAIALVPAVMALLLGSALARS |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl26892. Profile Description: Photosystem I protein M (PsaM). Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. The seed alignment for this model includes sequences from pfam07465 and additional sequences, as from Prochlorococcus. [Energy metabolism, Photosynthesis] |
| Pubmed ID |
18059494
|
| Domain |
CDD:421407 |
| Functional Category |
Others |
| Uniprot ID |
Q2JI37
|
| ORF Length (Amino Acid) |
30 |