Result : Q2JI23
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit IX |
| NCBI Accession ID | CP000240.1 |
| Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
| Left | 2927489 |
| Right | 2927608 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGATTTCACCAAGTTTCTCACCACTGCTCCGGTGGCATTTATCCTGTTTTCCAGCTTTGTTTTTGCCCTGTTCATCGAGATCAATCGCTTCTTCCCCGACATTTTGACGTTCTGA |
| Sequence | MADFTKFLTTAPVAFILFSSFVFALFIEINRFFPDILTF |
| Source of smORF | Swiss-Prot |
| Function | May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}. |
| Pubmed ID | 18059494 |
| Domain | CDD:420030 |
| Functional Category | Others |
| Uniprot ID | Q2JI23 |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5748913 | 5749044 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 2 | 2220418 | 2220546 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 3 | 3504030 | 3504149 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 4 | 1430824 | 1430937 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 5 | 679715 | 679834 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 6 | 5099537 | 5099656 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 7 | 4875738 | 4875857 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 8 | 2975515 | 2975634 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 9 | 5549867 | 5549986 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 10 | 4211954 | 4212073 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019751.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00561.22 | 0.7 | 7 | 2028 | same-strand | alpha/beta hydrolase fold |
| 2 | PF12697.9 | 0.7 | 7 | 2028 | same-strand | Alpha/beta hydrolase family |
| 3 | PF12146.10 | 0.7 | 7 | 2028 | same-strand | Serine aminopeptidase, S33 |
| 4 | PF00814.27 | 1.0 | 10 | 810.0 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 5 | PF02605.17 | 0.8 | 8 | 274.0 | same-strand | Photosystem I reaction centre subunit XI |
| 6 | PF00625.23 | 0.7 | 7 | 864 | opposite-strand | Guanylate kinase |
| 7 | PF04025.14 | 0.7 | 7 | 1679 | opposite-strand | Domain of unknown function (DUF370) |
++ More..