Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit IX |
NCBI Accession ID | CP000240.1 |
Organism | Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) |
Left | 2927489 |
Right | 2927608 |
Strand | + |
Nucleotide Sequence | ATGGCTGATTTCACCAAGTTTCTCACCACTGCTCCGGTGGCATTTATCCTGTTTTCCAGCTTTGTTTTTGCCCTGTTCATCGAGATCAATCGCTTCTTCCCCGACATTTTGACGTTCTGA |
Sequence | MADFTKFLTTAPVAFILFSSFVFALFIEINRFFPDILTF |
Source of smORF | Swiss-Prot |
Function | May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}. |
Pubmed ID | 18059494 |
Domain | CDD:420030 |
Functional Category | Others |
Uniprot ID | Q2JI23 |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5748913 | 5749044 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
2 | 2220418 | 2220546 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
3 | 3504030 | 3504149 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
4 | 1430824 | 1430937 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
5 | 679715 | 679834 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
6 | 5099537 | 5099656 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
7 | 4875738 | 4875857 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
8 | 2975515 | 2975634 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
9 | 5549867 | 5549986 | - | NZ_CP031941.1 | Nostoc sphaeroides |
10 | 4211954 | 4212073 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00561.22 | 0.7 | 7 | 2028 | same-strand | alpha/beta hydrolase fold |
2 | PF12697.9 | 0.7 | 7 | 2028 | same-strand | Alpha/beta hydrolase family |
3 | PF12146.10 | 0.7 | 7 | 2028 | same-strand | Serine aminopeptidase, S33 |
4 | PF00814.27 | 1.0 | 10 | 810.0 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
5 | PF02605.17 | 0.8 | 8 | 274.0 | same-strand | Photosystem I reaction centre subunit XI |
6 | PF00625.23 | 0.7 | 7 | 864 | opposite-strand | Guanylate kinase |
7 | PF04025.14 | 0.7 | 7 | 1679 | opposite-strand | Domain of unknown function (DUF370) |