Result : Q2J6N4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) |
| NCBI Accession ID | CP000249.1 |
| Organism | Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) |
| Left | 4439625 |
| Right | 4439882 |
| Strand | - |
| Nucleotide Sequence | ATGCCGATCCGGGTGGCGATTGTCTCGCCCGAGCAGGAGGTGTGGTCCGGCGACGCCGACATGGTCGTCGCCCGGACCACCGACGGTGATCTCGGCGTGCTGCCCGGCCATGTGCCGCTGCTGGGTCTGCTGGCGCCGGGCGGAACGGTCCGGGTCAAGACCGGTGGCCGGGAGATCTCGGCCTCGGTGGACGGCGGCTTCATCTCGGTGACACACCAGGGTGTCAGCATCCTCGCCGAGACCGCGAAGCTGACCTGA |
| Sequence | MPIRVAIVSPEQEVWSGDADMVVARTTDGDLGVLPGHVPLLGLLAPGGTVRVKTGGREISASVDGGFISVTHQGVSILAETAKLT |
| Source of smORF | Swiss-Prot |
| Function | Produces ATP from ADP in the presence of a proton gradient across the membrane. {ECO:0000255|HAMAP-Rule:MF_00530}. |
| Pubmed ID | 17151343 |
| Domain | CDD:421925 |
| Functional Category | Others |
| Uniprot ID | Q2J6N4 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4439625 | 4439882 | - | NC_007777.1 | Frankia casuarinae |
| 2 | 6431312 | 6431572 | - | NC_008278.1 | Frankia alni ACN14a |
| 3 | 1174783 | 1175046 | + | NC_014666.1 | Frankia inefficax |
| 4 | 6396613 | 6396894 | - | NZ_AP022870.1 | Phytohabitans flavus |
| 5 | 6208246 | 6208530 | - | NZ_CP058322.1 | Micromonospora carbonacea |
| 6 | 4156530 | 4156814 | - | NC_009380.1 | Salinispora tropica CNB-440 |
| 7 | 4568509 | 4568766 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 8 | 3941021 | 3941311 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 9 | 5767563 | 5767841 | - | NC_014391.1 | Micromonospora aurantiaca ATCC 27029 |
| 10 | 4434059 | 4434337 | - | NZ_CP045309.1 | Micromonospora terminaliae |
| 11 | 8150347 | 8150628 | - | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 12 | 1927369 | 1927584 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 13 | 217234 | 217506 | + | NZ_AP017457.1 | Aurantimicrobium minutum |
| 14 | 7308218 | 7308499 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 15 | 1766766 | 1767017 | + | NZ_CP017146.1 | Marisediminicola antarctica |
| 16 | 1479690 | 1479953 | - | NZ_CP044548.2 | Janibacter melonis |
| 17 | 1014045 | 1014290 | + | NZ_CP028913.1 | Agromyces badenianii |
| 18 | 667998 | 668255 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 19 | 1906358 | 1906576 | - | NC_022438.1 | Leifsonia xyli subsp. cynodontis DSM 46306 |
| 20 | 7798074 | 7798289 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 21 | 2407216 | 2407473 | + | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 22 | 662642 | 662920 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01923.20 | 0.73 | 16 | 833.5 | opposite-strand | Cobalamin adenosyltransferase |
| 2 | PF00006.27 | 0.95 | 21 | 1958.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 3 | PF02874.25 | 0.95 | 21 | 1958.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 4 | PF00231.21 | 0.95 | 21 | 2652 | same-strand | ATP synthase |
| 5 | PF00306.29 | 0.95 | 21 | 3661 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 6 | PF00213.20 | 0.91 | 20 | 5029.5 | same-strand | ATP synthase delta (OSCP) subunit |
| 7 | PF10739.11 | 0.64 | 14 | 13.0 | same-strand | Protein of unknown function (DUF2550) |
++ More..